DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and dpr16

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:326 Identity:66/326 - (20%)
Similarity:102/326 - (31%) Gaps:99/326 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    21 QVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTP-------NQQRISVVWNDDSS 78
            |:.:.|....:..|:..:..|:: .....|.:||.....|.:..       |..|.:.:.   .|
  Fly   200 QLSLPPLNATVQAGQHAYLPCKL-NQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLL---QS 260

Human    79 STLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVS 143
            :|||             .:|:|  |:.|.....|...........|..||  .|..:        
  Fly   261 TTLT-------------TLVSG--GALSTTATPVAALGNSFAHAVPGGQE--RGNSS-------- 300

Human   144 SLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIV 208
                ::.|.                     |||:.:...|.|.|.|:  :....:::.| :|:.|
  Fly   301 ----SLSWT---------------------LQIKYVNLEDAGWYECQ--LATEPKMSAK-VQLFV 337

Human   209 NVPPT--IQARQNIVNATANLGQSVTLVCDAEGFPEPT--MSWTKDGEQIEQEEDD--------- 260
            ..|.|  |..||..|.|    |..|.|.|...|..|..  :.|.:..:|:..|.:.         
  Fly   338 ITPRTELIGDRQRFVKA----GSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYT 398

Human   261 --EKYIFSDDS------SQLTIKKVDKNDEAEYICIAENKA----------GEQDATIHLKVFAK 307
              ::.||....      ..|.|..|.|.....|.|..||.|          ||..|:......|:
  Fly   399 QIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAAR 463

Human   308 P 308
            |
  Fly   464 P 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 19/100 (19%)
IG 124..190 CDD:214652 11/65 (17%)
Ig 211..307 CDD:325142 30/126 (24%)
Ig 306..438 CDD:325142 2/3 (67%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 32/188 (17%)
Ig <298..338 CDD:299845 10/75 (13%)
IG_like 352..447 CDD:214653 22/98 (22%)
Ig 358..439 CDD:143165 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.