DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and CG7166

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:659 Identity:131/659 - (19%)
Similarity:218/659 - (33%) Gaps:278/659 - (42%)


- Green bases have known domain annotations that are detailed below.


Human   132 GEDAVIVCDVVSSLPPTIIWKHKGRDVI------LKKDVRFIVLSNNYLQIRGIKKTDEGTYRCE 190
            ||...:.|.|.:.....::|: ||..|:      :.:|.||.::.:..|||.|:|..|.|.|.|:
  Fly    53 GETIELPCKVQNLGSFVLLWR-KGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQ 116

Human   191 -GRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQI 254
             |....|.:::    .|.:.||||::|..:....||..|.:|||.|.|.|.|.||:.|.|     
  Fly   117 LGDQENRDQVH----TVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFK----- 172

Human   255 EQEEDDEKYIFS-----DDSSQLTIKKVDKNDEAEYICIAENKAGEQDAT---IHLKVFAKPKIT 311
                   |.:||     .|||.|.::.||::....|.|.|:|  |.:|..   |.|.:.:.|:||
  Fly   173 -------KDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADN--GVKDRVSMDIQLTILSPPEIT 228

Human   312 YVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKAS-WTRPEKQEVHAPWNWQVGRQ 375
            ..::.........|.|.|...||....:.|..::..:.:.::.| :.|.::.             
  Fly   229 VEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRY------------- 280

Human   376 KGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQY 440
                                         ||.:::.|.||.|.|.|.|.|.:|:..:  |:||..
  Fly   281 -----------------------------SLIIRNFQPTDFGNYSCVADNALGRTKK--YIEVSG 314

Human   441 APKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPD 505
            .|   ||.                 .:.|..:|.|.|                            
  Fly   315 RP---GPA-----------------DFISPALSGFLD---------------------------- 331

Human   506 SENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYK 570
                  :||.|       .::|         |.|.:|:::                     |.|:
  Fly   332 ------HYNLT-------WTIE---------SIPPLDEIK---------------------LLYR 353

Human   571 AEWRAVGEEVWH--SKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQP 633
               |.:..|.:.  .||:                                         |:..:|
  Fly   354 ---RLLMNETYQHPGKWH-----------------------------------------EYHIKP 374

Human   634 VQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIR----HYLVRYRALSSEWKPEIRLPSGSDH 694
                                            :|||    |:|:.|                   
  Fly   375 --------------------------------TPIRTDGSHFLMSY------------------- 388

Human   695 VMLKSLDWNAEYEVYVVAENQQGKSKAAHF-VFRTSAQPTAIPANGSPTSGLSTG-----AIVGI 753
             ::|:|:.||.||..|.|:|:.|.::.:.. .|.|......:..:.....|:|:.     .:.||
  Fly   389 -LVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISPTVSGI 452

Human   754 LIVIFVLLL 762
            ::..|:|:|
  Fly   453 ILSAFILVL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 19/63 (30%)
Ig 211..307 CDD:325142 35/103 (34%)
Ig 306..438 CDD:325142 23/132 (17%)
Ig_3 447..519 CDD:316449 8/71 (11%)
FN3 534..631 CDD:238020 10/98 (10%)
fn3 639..720 CDD:306538 16/84 (19%)
Trypan_PARP <792..>864 CDD:330686
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/84 (27%)
Ig 56..116 CDD:143165 17/60 (28%)
IG_like 144..221 CDD:214653 31/90 (34%)
IGc2 151..209 CDD:197706 25/71 (35%)
IG_like 232..313 CDD:214653 21/124 (17%)
Ig 242..311 CDD:143165 20/112 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.