DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and dpr10

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:475 Identity:88/475 - (18%)
Similarity:147/475 - (30%) Gaps:188/475 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   132 GEDAVIVCDVVSSLPPTIIW-KHKGRDVI------LKKDVRFIVLSNNY--------LQIRGIKK 181
            |:.|.:.|.|......|:.| :|:...::      ...|.||   ..:|        |||:..::
  Fly    68 GKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRF---QTSYHRDIDEWTLQIKWAQQ 129

Human   182 TDEGTYRCEGRILARGEINFKDIQVIVNVPP--TIQARQNIVNATANLGQSVTLVCDAEGFPEPT 244
            .|.|.|.|:                 ::..|  :.....|||:           :.|||      
  Fly   130 RDAGVYECQ-----------------ISTQP
VRSYSVNLNIVD-----------LIDAE------ 160

Human   245 MSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENK----AGEQDATIH--LK 303
               |.|                       |.:...||:|.|  ||||:    :.::.|.:.  ::
  Fly   161 ---TSD-----------------------IMQQYYNDDAFY--IAENRVYQSSNDEFAGMFGPIQ 197

Human   304 VFAKPKIT-------YVENQTAMELEEQVTLTC--EASGDPIPSITWRTSTRNISSEEKASWTRP 359
            ..|.|..|       ||:..:.      :.|||  :.|.:|...|.|....:.:|.|...     
  Fly   198 TVAVPTATILGGPDLYVDKGST------INLTCIIKFSPEPPTHIFWYHQDKVLSEETSG----- 251

Human   360 EKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTAS 424
                         ||.|                 ...::|....|.|.:.......:|:|.|..|
  Fly   252 -------------GRLK-----------------FKTIKSEETKSILLIYDADLLHSGKYSCYPS 286

Human   425 NT--------IGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLL 481
            ||        :.|..:...::...||   ..||:..|       :|.   :..||          
  Fly   287 NTEIASIRVHVLQGERPEAMQTNAAP---AAVALACW-------SCH---FGQAT---------- 328

Human   482 PSSNYSNIKIYNTPSASYLEVTPDSE---NDFGNYNC-----------TAVNRIGQESLEFILVQ 532
                 ..:::.:|..|:.:.:...|.   ...|...|           |.|..|.::.|...|:.
  Fly   329 -----QAVRVISTMVAALVLLEACSSLLLQSGGGGGCPGGGSPAGGMPTRVREIREKPLTNSLLD 388

Human   533 ADTPSSPSIDQVEPYSSTAQ 552
            ...||:.|.::|...|..|:
  Fly   389 PKIPSTTSAERVNNGSRNAR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 17/72 (24%)
Ig 211..307 CDD:325142 19/103 (18%)
Ig 306..438 CDD:325142 27/148 (18%)
Ig_3 447..519 CDD:316449 12/85 (14%)
FN3 534..631 CDD:238020 6/19 (32%)
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
dpr10NP_729591.1 Ig 63..143 CDD:299845 18/94 (19%)
IG_like 210..297 CDD:214653 23/127 (18%)
IGc2 217..287 CDD:197706 18/110 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.