DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and dpr13

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:435 Identity:95/435 - (21%)
Similarity:151/435 - (34%) Gaps:110/435 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   185 GTYRCE-GRILARGEINFKDIQVIVNVPPTIQARQNIVNATANL----GQSV--TLVCDAEGFPE 242
            |.||.: ||:|.|.:.....|.:|..:     |...|.:.||:.    |::|  |:...|.   |
  Fly     6 GLYRIKNGRVLDRLQKPAALIFIIAYI-----AACGICDHTASASPGGGKTVAATMTTPAS---E 62

Human   243 PT---------MSWTKDGEQIEQEE-----------------DDEKYIFSDDSSQLT---IKKVD 278
            |:         ||.:|:||.:...:                 |....|  |..||.|   :::..
  Fly    63 PSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSFDSTNVI--DGQSQPTPTHLQEAV 125

Human   279 KNDEAEYICIAENKAGEQDATIHL-------------------KVFAKPKITYVENQTAMELEEQ 324
            ....:.....|::.||.....:|.                   .:|..|.....||.|.  :..|
  Fly   126 LQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTV--VTTQ 188

Human   325 VTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHE 389
            :..|..     :|      .|.:...|...||.|  |::.|.   ..||... .:....|..:| 
  Fly   189 IGATAH-----VP------CTVHHIGEGVVSWIR--KKDYHL---LTVGLTT-YSSDERFSATH- 235

Human   390 TLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLE---VQYAPKLQGPVAVY 451
                    ..|:...:|.:|.:|..|||.|.|..|.   ....|::|.   |:...::.||...|
  Fly   236 --------LKHSEDWTLQIKFVQLRDAGVYECQVST---HPPTSIFLHLSVVEARAEITGPPIRY 289

Human   452 TWEGNQVNITCEVFAYPSAT--ISWFRDGQLLPSSNYS---NIKIYNTP--SASYLEVTPDSEND 509
            ...|:.:.:.|.|.....|:  |.|:.|.:::   ||.   .|.:...|  .:|.|.:.......
  Fly   290 LTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI---NYDIDRGINVSTEPDFQSSELTIQRTRREH 351

Human   510 FGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQ 554
            .||:.|.|.|......|..|. :.|.|::.....|...:.|.|.|
  Fly   352 SGNFTCVASNTQPASVLVHIF-KGDNPAAMYHGHVGGSTKTTQSQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 3/4 (75%)
Ig 211..307 CDD:325142 26/149 (17%)
Ig 306..438 CDD:325142 30/134 (22%)
Ig_3 447..519 CDD:316449 19/78 (24%)
FN3 534..631 CDD:238020 6/21 (29%)
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
dpr13NP_001033956.2 V-set 180..276 CDD:284989 29/126 (23%)
IG_like 182..262 CDD:214653 24/107 (22%)
IG_like 285..362 CDD:214653 19/79 (24%)
IGc2 292..361 CDD:197706 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.