DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NCAM1 and babos

DIOPT Version :9

Sequence 1:	NP_001229536.1	Gene:	NCAM1 / 4684	HGNCID:	7656	Length:	884	Species:	Homo sapiens
Sequence 2:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster

Alignment Length:	121	Identity:	32/121 - (26%)
Similarity:	49/121 - (40%)	Gaps:	40/121 - (33%)

- Green bases have known domain annotations that are detailed below.

Human   121 KNAPTPQEFR------------------EGEDAVIVCDVVSSLPPT---IIWKHKGRDVILKKDV 164
            ::||:||...                  .|||.|:.|||.|:|..:   ::| :.|.:||  .:.
  Fly    47 QSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLW-YFGDNVI--SNG 108

Human   165 RFIVLSN-----NY-LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTI 214
            :.:|..|     || |.|........|:|.|  ::|..|.        :||...||
  Fly   109 KNLVQPNFKLDANYDLTILKASPQVAGSYLC--KVLPSGS--------VVNTKVTI 154

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NCAM1	NP_001229536.1	Ig1_NCAM-1	20..115	CDD:143273
		IG	124..190	CDD:214652	24/92 (26%)
		Ig	211..307	CDD:325142	2/4 (50%)
		Ig	306..438	CDD:325142
		Ig_3	447..519	CDD:316449
		FN3	534..631	CDD:238020
		fn3	639..720	CDD:306538
		Trypan_PARP	<792..>864	CDD:330686
babos	NP_001286719.1	ig	70..154	CDD:278476	26/96 (27%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	26/96 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900