DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and CG13506

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:400 Identity:78/400 - (19%)
Similarity:144/400 - (36%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   128 EFREGEDAVIVCDVVS-SLPPTIIWKHKGRDVILKK----DVRFIVLSNNYLQIRGIKKTDEGTY 187
            |.:.|:|.::.||..: .|...::| :|.|.:|...    ..|...:.||.:.:|.:...|...|
  Fly    80 EAKPGDDVILNCDARNFQLSNAVVW-YKNRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDY 143

Human   188 RCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTK-DG 251
            .||  ||.:                  :.||   :....:|..::::||.....:.:.::.: |.
  Fly   144 YCE
--ILPQ------------------RVRQ---HTALRVGARLSILCDDRDITDRSQTFRQGDH 185

Human   252 EQIE-----QEEDDEKYIFSDDSSQ----------LTIKKVDKNDEAEYICIAENKAGE-QDATI 300
            .::|     .:....|:.|:|.:.|          :.:..||:.:..:|.|:|::.:.. ...|:
  Fly   186 HKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTV 250

Human   301 HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVH 365
            |:.|...|.::...:....|......|.|.....||....:....:.:...:|.|.    |..||
  Fly   251 HIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSL----KDSVH 311

Human   366 APWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQD 430
                                            ..|.| ::|.::.:..:|.|||:|...|.||  
  Fly   312 --------------------------------NDHNR-TTLIVREVTDSDLGEYLCQVENAIG-- 341

Human   431 SQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYPSATISW-----------FRDGQLLPSS 484
            |..:.:.|.|.|:.. .....|.|||:|            |:.|           ..|.||..|.
  Fly   342 SNEVKVHV
SYNPETP-QFEDMTVEGNKV------------TLHWLVRSHQLLSEAMLDYQLTGSY 393

Human   485 NYSNIKIYNT 494
            .:|.:::..|
  Fly   394 TWSTVQVLET 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 16/66 (24%)
Ig 211..307 CDD:325142 19/112 (17%)
Ig 306..438 CDD:325142 23/131 (18%)
Ig_3 447..519 CDD:316449 12/58 (21%)
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/66 (24%)
IGc2 83..146 CDD:197706 15/63 (24%)
IG_like 176..254 CDD:214653 13/77 (17%)
Ig 176..239 CDD:299845 10/62 (16%)
I-set 258..349 CDD:254352 23/129 (18%)
Ig 275..348 CDD:143165 21/111 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.