DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and Lac

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:345 Identity:83/345 - (24%)
Similarity:148/345 - (42%) Gaps:68/345 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   108 ATVNVKIF-QKLMFKNAP-----TPQEFRE-GEDAVIVCDVVSSLPPTIIWKHKGRD-------- 157
            :|:.:.|| |:.:.:..|     |.::.:: |......|.|..:....:::.....|        
  Fly    12 STLLLAIFVQQTLAQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGS 76

Human   158 VILKKDVRFIVL----SNNY-LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTI--Q 215
            .::.||.||.:.    |:.| |||:.|::||.|||.|:..|....::: .::::.|..||.|  .
  Fly    77 TLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVS-AEVKLSVRRPPVISDN 140

Human   216 ARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKN 280
            :.|::|   |:.|..|.:.|.|.|:|.||::|.::...| ...|...|:    .:.|.||.|.|.
  Fly   141 STQSVV---ASEGSEVQMECYASGYPTPTITWRRENNAI-LPTDSATYV----GNTLRIKSVKKE 197

Human   281 DEAEYICIAENKAGEQD-ATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTS 344
            |...|.|:|:|...:.| ..|:::|...|.||....:....|:..:.|.|.....|.|:|.|...
  Fly   198 DRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD 262

Human   345 TRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLK 409
            ...:::.:..|.:.                         |..:.|..|..:.|        :|::
  Fly   263 DIQLANNQHYSISH-------------------------FATADEYTDSTLRV--------ITVE 294

Human   410 SIQYTDAGEYICTASNTIGQ 429
            ..||   |:|:|.|:|..|:
  Fly   295 KRQY---GDYVCKATNRFGE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 1/6 (17%)
IG 124..190 CDD:214652 21/84 (25%)
Ig 211..307 CDD:325142 31/98 (32%)
Ig 306..438 CDD:325142 24/124 (19%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
LacNP_523713.2 IG_like 36..131 CDD:214653 21/95 (22%)
FR1 37..50 CDD:409353 1/12 (8%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 1/13 (8%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 14/30 (47%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 4/7 (57%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 0/6 (0%)
Ig strand G 124..130 CDD:409353 0/6 (0%)
Ig_3 134..208 CDD:404760 27/81 (33%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 23/121 (19%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.