DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:425 Identity:95/425 - (22%)
Similarity:166/425 - (39%) Gaps:74/425 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    25 VPSQGE------ISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQ-------QRISVVWNDD 76
            :|..||      :.|.......| |..:.:...|:|...:.:.:...|       .|:|:...:.
  Fly   129 LPKFGELLQNVTVPVSREAVLQC-VVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEK 192

Human    77 SSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDV 141
            .:..|.|.:....|.|.|.|.:..:........::|.:...::.....|....|||.:..:.|..
  Fly   193 RAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAA 257

Human   142 VSSLPPTIIWKHKGRDVI-LKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARG--EINFKD 203
            ..|..|||.|:.:|.::| |......:..:.::|.|..:.:.:.|.|.|   |.:.|  ....|.
  Fly   258 TGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLC---IASNGIPPTVSKR 319

Human   204 IQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKD------GEQIEQEEDDEK 262
            :.:||:.||.|..:..:|.|.  |.|::||.|.:|.:|:....|.|:      ||:...|..:..
  Fly   320 VMLIVHFPPMIWIQNQLVGAA--LTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESG 382

Human   263 YIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTL 327
            |..   :.:|||.:||..|...|.|:|:|..|:.|..|        |:.::...|.|   ..:..
  Fly   383 YKI---TMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAI--------KLYHIPQTTTM---TTMAP 433

Human   328 TCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGR-------QKGQAGSAG-- 383
            |...:..|:..:.:....|..||:...:          .|:|:..|.       |:|::.|.|  
  Fly   434 TVSINTVPVVLVKYNKEQRYGSSQNSNT----------NPYNFNPGNSQQNTKLQRGKSNSKGSD 488

Human   384 ---------FPGSHETL----DGHMVVRSHARVSS 405
                     |.|:..:|    |.|....|.:..||
  Fly   489 QSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASS 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 18/102 (18%)
IG 124..190 CDD:214652 17/66 (26%)
Ig 211..307 CDD:325142 31/101 (31%)
Ig 306..438 CDD:325142 23/122 (19%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 15/93 (16%)
IG_like 137..230 CDD:214653 15/93 (16%)
IG_like 240..324 CDD:214653 21/86 (24%)
IGc2 247..310 CDD:197706 17/65 (26%)
Ig 327..419 CDD:299845 31/104 (30%)
IG_like 343..420 CDD:214653 26/87 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.