DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and CG33543

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:457 Identity:103/457 - (22%)
Similarity:173/457 - (37%) Gaps:58/457 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    18 VSLQVDIVPSQGEIS--VGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSST 80
            :|||    ||...|:  |.||....||..  .||.|..|..|.|:.....:.|:.:.........
  Fly    48 LSLQ----PSTPSITHFVNESFIIFCQTV--QKDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLA 106

Human    81 LTIYNANIDDAGIYKCVVTG-EDGSESEATVNVK----------IFQKLMFKNAPTPQEFREGED 134
            |...:..::|.|.:.|.|.| .:|:.:   |||:          :.||:.|......|..|||.|
  Fly   107 LVFEHIALEDRGNWTCEVNGNRNGNRN---VNVEREFLASFELLVNQKISFGKTEQVQSVREGRD 168

Human   135 AVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEI 199
            |::.|.|.....|.:.|.:.|..:......:...|||. |.||.:.:.|.|.|.|....:.....
  Fly   169 AMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCRAMRITPTFS 232

Human   200 NFKDIQVIVNV--PPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEK 262
            :...|.:::.:  .|.....:.:....|.:|.:|.|.|||.|.|.|:.:|..:.:.|  ...:.:
  Fly   233 DSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKGI--VGFNHR 295

Human   263 YIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTL 327
            ...:|..:.|.::..:.:...:|.|...|..|..:..|.|:...||.     .....:|::..| 
  Fly   296 IFVADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKPL-----GPRRFQLKKLYT- 354

Human   328 TCEASGDPIPSITWRTSTRNISSEEKASWTR----PEKQEVHAPWNWQVGRQKGQAGSAGFPGSH 388
                :|..:...|.|.|  |:|.|.:....|    .:.:...:..||...:|:    ...|.|..
  Fly   355 ----NGFELDIQTPRMS--NVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQR----DFSFHGGK 409

Human   389 ETLDGHMVVRSH--ARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVY 451
            ..:..|:...:.  .|.:|..|..:......:...||:..    |.|.:|...|     |.:...
  Fly   410 HFIIPHLETNTTYLMRAASRNLAGLSDWSPVKVFTTAAGC----SWSPWLYPSY-----GLILAL 465

Human   452 TW 453
            .|
  Fly   466 IW 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 27/107 (25%)
IG 124..190 CDD:214652 20/65 (31%)
Ig 211..307 CDD:325142 21/95 (22%)
Ig 306..438 CDD:325142 26/137 (19%)
Ig_3 447..519 CDD:316449 1/7 (14%)
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/59 (32%)
IG_like 256..336 CDD:214653 19/81 (23%)
IGc2 263..327 CDD:197706 16/65 (25%)
FN3 341..445 CDD:238020 20/119 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11036
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.