DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and DIP-kappa

DIOPT Version :10

Sequence 1:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:429 Identity:99/429 - (23%)
Similarity:165/429 - (38%) Gaps:87/429 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   132 GEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNN-------------YLQIRGIKKTD 183
            |.||::.|.|.:.....:.|.......||  .:...|:|.|             ||.|:.:::||
  Fly    88 GRDALMACVVENLKGYKVAWVRVDTQTIL--SIHHNVISQNSRISLTYNDHRSWYLHIKEVEETD 150

Human   184 EGTYRCEGRILARGEINFKD-------IQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFP 241
            .|.|.|        ::|...       :||:  |||.|.......:.....||:::|||.|.|:|
  Fly   151 RGWYMC--------QVNTDPMRSRKGYLQVV--V
PPIIVEGLTSNDMVVREGQNISLVCKARGYP 205

Human   242 EPTMSWTKDGEQIEQEEDDEKYIFSD------DSSQLTIKKVDKNDEAEYICIAENKAGEQ-DAT 299
            ||.:.|        :.||.|:.:...      |...|.|.||.:...|.|:|:|.|..... ...
  Fly   206 EPYVMW--------RREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKR 262

Human   300 IHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRN---ISSEEKASWTRPEK 361
            :||:|...|.::.........|.:.|.|.|.....| .||.:.|:.|.   ||...:|.    :|
  Fly   263 VHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYP-ASINYWTTERGDMIISDTSRAG----DK 322

Human   362 QETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYT 426
            .||..   .|..:.:...|.::::...|.|.|.|.|.|::|:...::.|:     ::..|.....
  Fly   323 YETTS---TVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKL
D-----EMPTPTTAII 379

Human   427 WEGNQVNITCE-----------VFAYPSATISWFRDGQLLPSSNYSN------IKIYNTPSASYL 474
            .|.:.:|.:.:           ..|.|...:..:|||  ...:|..|      ..:.|.|.|.: 
  Fly   380 SEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDG--AQGNNAGNNGDNNQTPVRNPPGAFH- 441

Human   475 EVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSP 513
                :|......:|..|...:|.::..|.:.:..:.|.|
  Fly   442 ----NSAGSLAQHNLLAKIMLGIKTQSFGIFKRLSSSLP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653 18/70 (26%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 3/16 (19%)
Ig 211..307 CDD:472250 30/102 (29%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 1/3 (33%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 26/108 (24%)
Ig strand A 306..311 CDD:143277 1/4 (25%)
Ig strand A' 315..319 CDD:143277 0/3 (0%)
Ig strand B 324..332 CDD:143277 3/7 (43%)
Ig strand C 338..344 CDD:143277 2/5 (40%)
Ig strand C' 347..350 CDD:143277 1/5 (20%)
Ig strand D 368..374 CDD:143277 1/5 (20%)
Ig strand E 377..383 CDD:143277 1/5 (20%)
Ig strand F 391..399 CDD:143277 4/7 (57%)
Ig strand G 402..412 CDD:143277 2/9 (22%)
IG_like 421..499 CDD:214653 17/94 (18%)
Ig strand B 432..436 CDD:409353 1/3 (33%)
Ig strand C 445..449 CDD:409353 0/3 (0%)
Ig strand E 472..476 CDD:409353 0/3 (0%)
Ig strand F 486..491 CDD:409353 1/4 (25%)
fn3 511..598 CDD:394996 2/3 (67%)
fn3 612..693 CDD:394996
PRK12323 <913..1108 CDD:481241
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 22/97 (23%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 2/12 (17%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 28/98 (29%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/11 (9%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 24/93 (26%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 1/3 (33%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.