DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and Dscam4

DIOPT Version :10

Sequence 1:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:1015 Identity:222/1015 - (21%)
Similarity:364/1015 - (35%) Gaps:201/1015 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    18 VSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFS---------------PNGEKL----- 62
            ||.:.:.:.|..|:.:           |||..:.:.|||               ..|..|     
  Fly   402 VSNEWEQIQSTAELQL-----------GDASPELLYWFSEQTLQPGPTVSLKCVATGNPLPQFTW 455

Human    63 ------TPNQQRI----SVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQK 117
                  .|:..|.    .|..:||..|.:.|.|...:|.|.|.|......|..|. :..|.|:..
  Fly   456 SLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSH-SAKVNIYGL 519

Human   118 LMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKK- 181
            ...:..|..... .|.|.::.|.|.......|.|:..|:.:.:.:..|  ..:|..|.|..::: 
  Fly   520 PYIREMPKITGI-SGSDLIVKCPVAGYPIDKIHWERDGQTLPINRRQR--AYNNGTLIIEQLQRL 581

Human   182 TDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCD-AEGFPEPTM 245
            .|.|||.|..:...: :.:.:::::.|.|||.|...|.:.|.... |....:.|. .||....:.
  Fly   582 EDAGTYTCMAQNKQK-QTSRRNVEIQVLVPPKIMPIQAMTNMLRE-GMRAAISCQILEGDLPVSF 644

Human   246 SWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKI 310
            .|.::|:.:....::......:.|:.|.|:.:..:....|.|||.|.||.:..|:.|.|...||.
  Fly   645 RWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKW 709

Human   311 TYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVVRSHA 375
            ......::.:....|.|.|::||.|.|:|||:.:......|.|.....|..|...:|        
  Fly   710 ILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLFPNG-------- 766

Human   376 RVSSLTLKSIQYTDAGEYICTASNTIGQD-SQSMYLEVQYAPKLQGPV-AVYTWEGNQVNITCEV 438
               ::..|.|.....|.::|.|.|.||.. |:.::|:|......|... .:...:|.||::.|.|
  Fly   767 ---TIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNV 828

Human   439 -------FAYPSATISWFRDGQLLPSSNYS-NIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRI 495
                   |.:.......:.|..|  .|.|: ..::.:....|.|.::.....|.|.|.|.|.|..
  Fly   829 QGDNPIDFKWKIQATQQYLDESL--DSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAF 891

Human   496 GQESLEFILVQADTPSSPSIDQVEPYSS-TAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKW 559
            ||:.:...|:..:.|..|...::....| :.|:.:.:|.| |..||.:|...::.:.:     .|
  Fly   892 GQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFA-GNSPIEEYHIYYKQISD-----IW 950

Human   560 YDAKEASMEGIVTIVG---LKPETTYAVRLAALNGKGLGEISAASEFKTQPVRE-PSAPKLEGQM 620
            .:|:..::.|..|::.   |:|...|.:|::|.|..|..|.|...:..|  :.| ||.|.| ...
  Fly   951 QNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTT--LEEVPSGPPL-AVR 1012

Human   621 GEDGNSIKV----NLIKQDDGGSPIRHYLVRYR-ALSSEWKP------------EIRLPSGSDHV 668
            .|..:|.::    :..::|.....:..|.|.|: :|:.|.|.            |:|...|.:.|
  Fly  1013 AEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETV 1077

Human   669 MLKSLDWNAEYEVYVVAENQQG-----KSKAAHFVFRTSAQP-----------TAIPANGSP--T 715
             |.:|:...:|.|.|.|...||     |..|...:....:.|           |:|....||  .
  Fly  1078 -LANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDI 1141

Human   716 SGLSTGAIVGILIVIFVLLLVVVD----------------ITCYFLNKCGLFMCIAVNLCGKAGP 764
            .| ..|.|.|     :.:..:.||                :|...|.|...: .:.|....|.|.
  Fly  1142 DG-QNGKIKG-----YKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNY-TVWVLAYTKVGD 1199

Human   765 GAKGK--------DMEEGKAAFSKDESKEPIVEVRTEEERTPNHD------------GGKH--TE 807
            |.|.|        |:.....|.....:....:.:.......||.|            ||:.  |.
  Fly  1200 GMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTH 1264

Human   808 PNETTPLTEPELPADTTATVEDMLPSVTTVTTNSDTITETFATAQNSPTSETTTLTSSIAPPATA 872
            .....|..|..                .||.|......:.:.||       :|.:..........
  Fly  1265 KRLLGPFVEMH----------------ETVRTQESATYQFWLTA-------STKMGEGEKTQVVT 1306

Human   873 TPDSNSVPA-----GQ--ATPSKG----PSASAPSPAPAS 901
            .|.:|.|||     .|  .||.|.    |.....:|||.:
  Fly  1307 VPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVT 1346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451 26/125 (21%)
Ig strand A 20..25 CDD:409451 0/4 (0%)
Ig strand A' 28..32 CDD:409451 1/3 (33%)
Ig strand B 34..44 CDD:409451 0/9 (0%)
Ig strand C 50..56 CDD:409451 1/5 (20%)
Ig strand C' 59..61 CDD:409451 1/1 (100%)
Ig strand D 69..75 CDD:409451 1/9 (11%)
Ig strand E 77..85 CDD:409451 2/7 (29%)
Ig strand F 92..100 CDD:409451 3/7 (43%)
Ig strand G 104..115 CDD:409451 2/10 (20%)
IG_like 124..190 CDD:214653 16/66 (24%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig 211..307 CDD:472250 24/96 (25%)
Ig strand B 231..235 CDD:409353 0/3 (0%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 1/3 (33%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 27/106 (25%)
Ig strand A 306..311 CDD:143277 2/4 (50%)
Ig strand A' 315..319 CDD:143277 0/3 (0%)
Ig strand B 324..332 CDD:143277 3/7 (43%)
Ig strand C 338..344 CDD:143277 3/5 (60%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 0/5 (0%)
Ig strand E 377..383 CDD:143277 0/5 (0%)
Ig strand F 391..399 CDD:143277 3/7 (43%)
Ig strand G 402..412 CDD:143277 3/10 (30%)
IG_like 421..499 CDD:214653 20/86 (23%)
Ig strand B 432..436 CDD:409353 1/3 (33%)
Ig strand C 445..449 CDD:409353 0/3 (0%)
Ig strand E 472..476 CDD:409353 2/3 (67%)
Ig strand F 486..491 CDD:409353 2/4 (50%)
fn3 511..598 CDD:394996 21/90 (23%)
fn3 612..693 CDD:394996 25/102 (25%)
PRK12323 <913..1108 CDD:481241
Dscam4NP_001261571.1 Ig 31..124 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 63..66 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 102..107 CDD:409353
Ig strand G 115..119 CDD:409353
Ig 235..326 CDD:472250
Ig strand B 253..257 CDD:409353
Ig strand C 266..270 CDD:409353
Ig strand E 292..296 CDD:409353
Ig strand F 306..311 CDD:409353
Ig strand G 319..322 CDD:409353
IgC2_3_Dscam 329..417 CDD:409549 4/14 (29%)
Ig strand A 330..335 CDD:409549
Ig strand A' 338..342 CDD:409549
Ig strand B 345..355 CDD:409549
Ig strand C 360..366 CDD:409549
Ig strand C' 367..370 CDD:409549
Ig strand E 383..389 CDD:409549
Ig strand F 396..404 CDD:409549 1/1 (100%)
Ig strand G 407..417 CDD:409549 2/9 (22%)
IgI_4_Dscam 422..516 CDD:409548 20/94 (21%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 0/8 (0%)
Ig strand C 451..457 CDD:409548 0/5 (0%)
Ig strand C' 459..462 CDD:409548 0/2 (0%)
Ig strand D 467..475 CDD:409548 1/7 (14%)
Ig strand E 479..488 CDD:409548 3/8 (38%)
Ig strand F 495..503 CDD:409548 3/7 (43%)
Ig strand G 506..516 CDD:409548 3/10 (30%)
IgI_5_Dscam 520..607 CDD:409550 17/90 (19%)
Ig strand A 520..522 CDD:409550 0/1 (0%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 1/6 (17%)
Ig strand C 548..554 CDD:409550 2/5 (40%)
Ig strand C' 555..557 CDD:409550 0/1 (0%)
Ig strand D 564..568 CDD:409550 1/5 (20%)
Ig strand E 571..577 CDD:409550 2/5 (40%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 0/9 (0%)
Ig 610..703 CDD:472250 23/93 (25%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 0/3 (0%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 2/4 (50%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 27/105 (26%)
Ig strand A 706..710 CDD:409546 2/3 (67%)
Ig strand A' 715..719 CDD:409546 0/3 (0%)
Ig strand B 722..731 CDD:409546 3/8 (38%)
Ig strand C 737..743 CDD:409546 3/5 (60%)
Ig strand C' 749..752 CDD:409546 1/2 (50%)
Ig strand D 760..763 CDD:409546 1/2 (50%)
Ig strand E 766..772 CDD:409546 1/16 (6%)
Ig strand F 779..787 CDD:409546 3/7 (43%)
Ig strand G 792..801 CDD:409546 2/8 (25%)
Ig 804..889 CDD:472250 18/86 (21%)
Ig strand B 822..826 CDD:409353 1/3 (33%)
Ig strand C 835..839 CDD:409353 1/3 (33%)
FN3 <850..1254 CDD:442628 91/422 (22%)
Ig strand F 882..887 CDD:409353 2/4 (50%)
FN3 906..999 CDD:238020 23/98 (23%)
fn3 1117..1203 CDD:394996 18/92 (20%)
FN3 1185..>1580 CDD:442628 35/186 (19%)
FN3 1405..1494 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.