DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and dpr9

DIOPT Version :9

Sequence 1:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:619 Identity:122/619 - (19%)
Similarity:187/619 - (30%) Gaps:227/619 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    67 QRISVVWNDDSSSTLTIYNANI--DDAGIYKCVV---TGEDGSES--EATVNVKIFQKLMFKNAP 124
            ||.|....|.|||...:.|..:  ..||..:...   ||.|||.|  .::.|.|       ...|
  Fly   129 QRDSYNSKDMSSSNNALPNEGVGGSAAGAGEAAAPGPTGIDGSGSGNNSSGNNK-------NGHP 186

Human   125 TPQEFREGEDAVIVCD----------VVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGI 179
            ........|.|.:..|          .::.:|.:.:  ||....           |:|       
  Fly   187 AAGSGAASESAALTTDASRSSVGGATTITGIPSSSL--HKASSA-----------SSN------- 231

Human   180 KKTDEGTYRCEGRILARG-EINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEP 243
                  |:..:   ||.| ..|..|::...|..|... :....|.||.||::..|.|..:.....
  Fly   232 ------TFSSQ---LASGFHRNSIDLEEARNAGPYFD-KAFSKNVTALLGKTAYLNCRVKNLGNK 286

Human   244 TM----SWTKDGEQIEQEEDDE-----KYIFSDDSS------------QLTIKKVDKNDEAEYIC 287
            ||    ||.:       ..|..     :|.::.|..            .|.||.....|...|.|
  Fly   287 TMLLQVSWVR-------HRDIHLLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYEC 344

Human   288 IAENKAGEQDAT-------IHL-------KVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPS 338
                    |.:|       |||       ::...|.: |:|:.:.      :.|||.....|.|.
  Fly   345 --------QVSTTPHMSHYIHLNVVEPSTEIIGAPDL-YIESGST------INLTCIIQNSPEPP 394

Human   339 --ITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVV--RS 399
              |.|..:....|..:..::..|.                               .|..||  :.
  Fly   395 AYIFWNHNNAFPSHPQIINYDSPR-------------------------------GGVSVVTNKG 428

Human   400 HARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEV 464
            ....|.|.:||.:.:|:|.|.|..||.              .||               ::|..|
  Fly   429 DTTTSFLLIKSARPSDSGHYQCNPSNA--------------KPK---------------SVTVHV 464

Human   465 FAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAV---NRIGQESL 526
            ....|.::|     :.:||||.:.....::|.|..|.|            |..|   .::|....
  Fly   465 LNGVSHSVS-----RGVPSSNAARGTSASSPLAHSLSV------------CVPVCVLLQLGACRW 512

Human   527 EFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI-----------LKYKAEWRAVGEEV 580
            ...|:.|...:.|      |..||.:...:.|.:.|..||           |:::..|      .
  Fly   513 IAALLGAALATPP------PLRSTRRATGERPGSPGCAPIACDMRHFLASVLRWQWRW------C 565

Human   581 WHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAA 614
            |...|...::......     |||::.   |:||
  Fly   566 WRWHWKGTQQQDPRHY-----LKPQSR---RVAA 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 18/54 (33%)
IG 124..190 CDD:214652 10/75 (13%)
Ig 211..307 CDD:325142 26/130 (20%)
Ig 306..438 CDD:325142 25/135 (19%)
Ig_3 447..519 CDD:316449 14/74 (19%)
FN3 534..631 CDD:238020 18/92 (20%)
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
dpr9NP_001287332.1 Ig 263..361 CDD:299845 25/112 (22%)
IG_like 263..360 CDD:214653 25/111 (23%)
IG_like 371..464 CDD:214653 28/159 (18%)
IGc2 377..456 CDD:197706 22/129 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.