DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NCAM1 and DIP-lambda

DIOPT Version :10

Sequence 1:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:431 Identity:93/431 - (21%)
Similarity:181/431 - (41%) Gaps:84/431 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    27 SQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE----------KLTPNQQRISVVWNDDSSSTL 81
            |...:.:|....|.| |..:.....::|...:.:          .|.|   |:||..|..::..|
  Fly    57 SNTTVPIGRDISFTC-VVDNLGHYRVAWIKSDSKAILGIHTHMVSLNP---RLSVTHNGHNTWKL 117

Human    82 TIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQE--FREGEDAVIVCDVVSS 144
            .|....|:|:|.|.|.|..:........::|.:...::......|::  .:||....::|.|...
  Fly   118 HISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGV 182

Human   145 LPPTIIWKHK-GRDVILKKDVR----FIVLSNNYLQIRGIKKTDEGTYRCEGRILARG---EINF 201
            ..|.::|:.: |:::||:.|.|    |..:....|.:..::::|.|.|.|   |.:.|   .:: 
  Fly   183 PRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNC---IASNGIPPSVS- 243

Human   202 KDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFS 266
            |...|.||..||::|...:|.|...  :.|||.|..|.||:|...|.:....|:. .:..||..|
  Fly   244 KRFNVYVNFSPTVKAISQLVGAPVE--REVTLECIVEVFPKPLNGWYRSEGNIKL-HNGNKYNIS 305

Human   267 DD-------SSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQ 324
            ::       ...|||:.:.|:|...|.|.:.|..|:.::.|.|:              .:.|..:
  Fly   306 EEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQ--------------ELRLPPK 356

Human   325 VTLTCEASGDPIPSI--TWRTSTRNISSEEK-------------ASWTRPEKQETLDGHMVVR-S 373
            :|.|      |.|.:  |.::..::.:|.:|             |:..:.|.::..:|..::: :
  Fly   357 LTTT------PTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFANQIQQENEDHNEGFDLLKFT 415

Human   374 HARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQY 414
            ::..|::.|:|      |.    .::.|.::..::|...||
  Fly   416 NSENSNIVLES------GH----INSMINKEDVNIYHPKQY 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451 21/98 (21%)
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451 0/3 (0%)
Ig strand B 34..44 CDD:409451 3/9 (33%)
Ig strand C 50..56 CDD:409451 1/5 (20%)
Ig strand C' 59..61 CDD:409451 0/11 (0%)
Ig strand D 69..75 CDD:409451 2/5 (40%)
Ig strand E 77..85 CDD:409451 2/7 (29%)
Ig strand F 92..100 CDD:409451 4/7 (57%)
Ig strand G 104..115 CDD:409451 1/10 (10%)
IG_like 124..190 CDD:214653 17/72 (24%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig 211..307 CDD:472250 29/102 (28%)
Ig strand B 231..235 CDD:409353 3/3 (100%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 1/3 (33%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 17/121 (14%)
Ig strand A 306..311 CDD:143277 0/4 (0%)
Ig strand A' 315..319 CDD:143277 0/3 (0%)
Ig strand B 324..332 CDD:143277 2/7 (29%)
Ig strand C 338..344 CDD:143277 1/7 (14%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 0/6 (0%)
Ig strand E 377..383 CDD:143277 1/5 (20%)
Ig strand F 391..399 CDD:143277 1/7 (14%)
Ig strand G 402..412 CDD:143277 1/9 (11%)
IG_like 421..499 CDD:214653
Ig strand B 432..436 CDD:409353
Ig strand C 445..449 CDD:409353
Ig strand E 472..476 CDD:409353
Ig strand F 486..491 CDD:409353
fn3 511..598 CDD:394996
fn3 612..693 CDD:394996
PRK12323 <913..1108 CDD:481241
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 21/96 (22%)
Ig strand B 67..71 CDD:409353 1/3 (33%)
Ig strand E 115..119 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 22/100 (22%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 186..190 CDD:409353 0/3 (0%)
Ig strand E 204..219 CDD:409353 3/14 (21%)
Ig strand F 229..234 CDD:409353 2/7 (29%)
Ig strand G 243..246 CDD:409353 1/3 (33%)
IG_like 271..349 CDD:214653 23/78 (29%)
Ig strand B 271..275 CDD:409353 3/3 (100%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 1/11 (9%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.