DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6421 and CG14823

DIOPT Version :9

Sequence 1:NP_652048.2 Gene:CG6421 / 46813 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_729205.1 Gene:CG14823 / 38772 FlyBaseID:FBgn0035734 Length:263 Species:Drosophila melanogaster


Alignment Length:126 Identity:41/126 - (32%)
Similarity:64/126 - (50%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CLTCICEAISGCNATAIC--TSAEKGACGIFRITWGYWVDAGKLTVNGEHPDSEKA--FINCAKD 95
            ||.|:....:. |..|||  ....:..|||:||:..||.||.::.    .||...|  :..|..|
  Fly   138 CLDCMATTATD-NIPAICRHRGRPEEPCGIYRISHVYWQDALRII----DPDDSLARDYGRCVVD 197

  Fly    96 PHCAADLVQNYMKKF-NQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSV--FEECIE 153
            ..||..:|::|:::: .:|||.||.::|.|:.|:|..|..||:...|....|.  .|.|::
  Fly   198 VQCAERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLGSLSERRLENCLK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 40/122 (33%)
CG14823NP_729205.1 Destabilase 136..256 CDD:283215 40/122 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DQ45
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - P PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.