powered by:
Protein Alignment CG6421 and ilys-1
DIOPT Version :9
Sequence 1: | NP_652048.2 |
Gene: | CG6421 / 46813 |
FlyBaseID: | FBgn0025827 |
Length: | 161 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500208.2 |
Gene: | ilys-1 / 183474 |
WormBaseID: | WBGene00016668 |
Length: | 73 |
Species: | Caenorhabditis elegans |
Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
Similarity: | 22/48 - (45%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 QNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEEC 151
:||..::...|:..|..:|..:||.|..|..||:......:....::|
Worm 21 ENYYHRYKSQCDGLGMGECEVFARNHNGGPTGCRNPGTLEYWQSIQKC 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11195 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.