DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6421 and ilys-5

DIOPT Version :9

Sequence 1:NP_652048.2 Gene:CG6421 / 46813 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001024594.1 Gene:ilys-5 / 180928 WormBaseID:WBGene00017691 Length:139 Species:Caenorhabditis elegans


Alignment Length:126 Identity:42/126 - (33%)
Similarity:58/126 - (46%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLVLSPSLVQGQGHVLDKPVTELCLTCICEAISGCNATAICTSAEKGACGIFRITWGYWVDAGKL 76
            ||:||.::..         |:..||.|||...|||............:||.::|..||:.|.|:.
 Worm     6 LLLLSVAIAY---------VSADCLHCICMRESGCKPIGCHMDVGSLSCGYYQIKIGYYEDCGQP 61

  Fly    77 TVN-GEHPDSEKAFINCAKDPHCAADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGC 136
            |.. ||  .:|.|:..||.|.:||...|:||..::...||..|...|...:|.|..|..||
 Worm    62 TKKAGE--TTEAAWKRCADDLNCATTCVENYYNRYKSQCNGLGMGACQIMSRNHNGGPRGC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 37/106 (35%)
ilys-5NP_001024594.1 Destabilase 17..135 CDD:283215 37/106 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 1 0.950 - 0 Normalized mean entropy S12255
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14375
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.