DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6421 and ilys-3

DIOPT Version :9

Sequence 1:NP_652048.2 Gene:CG6421 / 46813 FlyBaseID:FBgn0025827 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_500206.1 Gene:ilys-3 / 177033 WormBaseID:WBGene00016670 Length:139 Species:Caenorhabditis elegans


Alignment Length:118 Identity:37/118 - (31%)
Similarity:53/118 - (44%) Gaps:3/118 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CLTCICEAISGCNATAICTSAEKGACGIFRITWGYWVDAGKLT-VNGEHPDSEKAFINCAKDPHC 98
            ||.|||...|||............:||.::|...|:.|.|:.| .:||  .:|.|:..||.|..|
 Worm    20 CLHCICMRESGCKPIGCNMDVGSLSCGYYQIKLPYYEDCGQPTKKSGE--TTEAAWKRCANDLSC 82

  Fly    99 AADLVQNYMKKFNQDCNDDGEMDCHDYARIHKLGAYGCQADMPYNFQSVFEEC 151
            |...|:||..::...|...|:..|...||.|..|..||:......:.:..:.|
 Worm    83 ATTCVENYYNRYKSQCAGTGQGACEVMARNHNGGPQGCKHSGTLGYWNGIKSC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6421NP_652048.2 Destabilase 32..151 CDD:283215 36/116 (31%)
ilys-3NP_500206.1 Destabilase 17..135 CDD:310240 36/116 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I6517
eggNOG 1 0.900 - - E1_2DQ45
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I3946
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46392
OrthoDB 1 1.010 - - D1343143at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14605
orthoMCL 1 0.900 - - OOG6_109484
Panther 1 1.100 - - O PTHR11195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.