| Sequence 1: | NP_002474.4 | Gene: | CEACAM6 / 4680 | HGNCID: | 1818 | Length: | 344 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031761715.1 | Gene: | ceacam8l / 101730286 | XenbaseID: | XB-GENE-22169429 | Length: | 407 | Species: | Xenopus tropicalis |
| Alignment Length: | 290 | Identity: | 96/290 - (33%) |
|---|---|---|---|
| Similarity: | 132/290 - (45%) | Gaps: | 22/290 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Human 65 YSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDL 129
Human 130 VNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLS 194
Human 195 NGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSC 259
Human 260 HAASNPPAQYSWFINGT-FQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVS---- 319
Human 320 -----GSAPVLSAVATVGITIGVLARVALI 344 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CEACAM6 | NP_002474.4 | IgV_CEACAM_D1 | 36..140 | CDD:409430 | 23/74 (31%) |
| Ig strand B | 51..55 | CDD:409430 | |||
| Ig strand C | 64..68 | CDD:409430 | 1/2 (50%) | ||
| Ig strand E | 105..109 | CDD:409430 | 2/3 (67%) | ||
| Ig strand F | 119..124 | CDD:409430 | 2/4 (50%) | ||
| Ig strand G | 133..136 | CDD:409430 | 0/2 (0%) | ||
| IgI_hCEACAM_2_4_6_like | 146..234 | CDD:409402 | 34/87 (39%) | ||
| Ig strand B | 163..167 | CDD:409402 | 1/3 (33%) | ||
| Ig strand C | 176..180 | CDD:409402 | 2/3 (67%) | ||
| Ig strand E | 198..202 | CDD:409402 | 2/3 (67%) | ||
| Ig strand F | 212..217 | CDD:409402 | 2/4 (50%) | ||
| Ig strand G | 227..230 | CDD:409402 | 2/2 (100%) | ||
| IgC2_CEACAM5-like | 243..318 | CDD:409540 | 24/75 (32%) | ||
| Ig strand B | 255..259 | CDD:409540 | 1/3 (33%) | ||
| Ig strand C | 268..272 | CDD:409540 | 1/3 (33%) | ||
| Ig strand E | 285..289 | CDD:409540 | 1/3 (33%) | ||
| Ig strand F | 296..301 | CDD:409540 | 2/4 (50%) | ||
| Ig strand G | 311..314 | CDD:409540 | 1/2 (50%) | ||
| ceacam8l | XP_031761715.1 | Ig | 29..132 | CDD:416386 | 23/74 (31%) |
| FR1 | 30..48 | CDD:409353 | |||
| Ig strand A | 30..32 | CDD:409353 | |||
| Ig strand A' | 37..39 | CDD:409353 | |||
| Ig strand B | 42..49 | CDD:409353 | |||
| CDR1 | 49..56 | CDD:409353 | |||
| FR2 | 57..62 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 57..61 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 63..84 | CDD:409353 | 4/20 (20%) | ||
| Ig strand C' | 71..76 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 81..84 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 91..117 | CDD:409353 | 10/25 (40%) | ||
| Ig strand D | 91..96 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 98..102 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 112..117 | CDD:409353 | 2/4 (50%) | ||
| CDR3 | 118..124 | CDD:409353 | 0/5 (0%) | ||
| FR4 | 125..132 | CDD:409353 | 1/7 (14%) | ||
| Ig strand G | 125..131 | CDD:409353 | 1/6 (17%) | ||
| Ig | 139..222 | CDD:416386 | 34/86 (40%) | ||
| Ig strand A | 139..142 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 145..150 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 154..160 | CDD:409353 | 3/5 (60%) | ||
| Ig strand C | 166..171 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 173..176 | CDD:409353 | 1/2 (50%) | ||
| Ig strand D | 178..182 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 185..190 | CDD:409353 | 3/4 (75%) | ||
| Ig strand F | 200..208 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 212..221 | CDD:409353 | 5/8 (63%) | ||
| Ig strand A' | 233..236 | CDD:409353 | 0/2 (0%) | ||
| Ig_3 | 236..291 | CDD:404760 | 18/54 (33%) | ||
| Ig strand B | 241..249 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 255..259 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 262..265 | CDD:409353 | 2/2 (100%) | ||
| Ig strand E | 270..275 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 283..291 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 294..304 | CDD:409353 | 4/9 (44%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I40483 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 158 | 1.000 | Inparanoid score | I12550 |
| NCBI | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D241176at32523 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR44337 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X34 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 7.070 | |||||