DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEACAM6 and ceacam8l

DIOPT Version :10

Sequence 1:NP_002474.4 Gene:CEACAM6 / 4680 HGNCID:1818 Length:344 Species:Homo sapiens
Sequence 2:XP_031761715.1 Gene:ceacam8l / 101730286 XenbaseID:XB-GENE-22169429 Length:407 Species:Xenopus tropicalis


Alignment Length:290 Identity:96/290 - (33%)
Similarity:132/290 - (45%) Gaps:22/290 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    65 YSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDL 129
            :|||||...|.|:.|...:......|.||.|..|....||.||.|..:...|.|.||:.:..::.
 Frog    58 FSWYKGSSADTNNQIFSVIPSANSVTKGPQYFPRANWLPNGSLQISGLVPTDQGNYTVLMYTAES 122

Human   130 VNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLS 194
            ..:: |....||..:....||::|..|.|:: .|..||... .....||..||  :|:.|.|.||
 Frog   123 TTQD-TVSLPV
YEPVSSSGISTDNKEPQENQ-PVTLTCSAN-NAEQILWSKNG--VPLPPGLTLS 182

Human   195 NGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSC 259
            ..|.|||...:.|:|.|.|.||..|..|...|||.||.|.|||:...|. .......|.:.:|.|
 Frog   183 ADNRTLTFPRISRSDTGQYRCEASNAVSKIISDPYTLTVN
YGPENLKIK-GTLQVTSGYSTSLEC 246

Human   260 HAASNPPAQYSWFINGT-FQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVS---- 319
            .|.|.|...|.|..||| .:..|..|:|...|..::|:|.|...||.|.|:|.|...::|:    
 Frog   247 SADSVPAPTYQWKFNGTNLESQTNTLYIQQATPESAGNYTCIGTNSVTKLSRETSVYVSVNDYNP 311

Human   320 -----GSAPVLSAVATVGITIGVLARVALI 344
                 |..|:      .||.|.::..:||:
 Frog   312 SDNPIGPGPI------AGIAIAIILVIALV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEACAM6NP_002474.4 IgV_CEACAM_D1 36..140 CDD:409430 23/74 (31%)
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430 2/3 (67%)
Ig strand C 64..68 CDD:409430 1/2 (50%)
CDR2 70..91 CDD:409430 4/20 (20%)
Ig strand C' 78..83 CDD:409430 1/4 (25%)
Ig strand C' 88..91 CDD:409430 0/2 (0%)
FR3 98..124 CDD:409430 10/25 (40%)
Ig strand D 98..103 CDD:409430 1/4 (25%)
Ig strand E 105..109 CDD:409430 2/3 (67%)
Ig strand F 119..124 CDD:409430 2/4 (50%)
CDR3 125..132 CDD:409430 0/6 (0%)
FR4 133..140 CDD:409430 1/6 (17%)
Ig strand G 133..139 CDD:409430 1/5 (20%)
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402 34/87 (39%)
Ig strand A 146..150 CDD:409402 0/3 (0%)
Ig strand A' 153..158 CDD:409402 2/4 (50%)
Ig strand B 163..169 CDD:409402 3/5 (60%)
Ig strand C 176..181 CDD:409402 2/4 (50%)
Ig strand C' 183..186 CDD:409402 0/2 (0%)
Ig strand D 190..194 CDD:409402 1/3 (33%)
Ig strand E 197..202 CDD:409402 3/4 (75%)
Ig strand F 212..220 CDD:409402 3/7 (43%)
Ig strand G 224..233 CDD:409402 5/8 (63%)
IgC2_CEACAM5-like 243..318 CDD:409540 24/75 (32%)
Ig strand A 243..249 CDD:409540 0/5 (0%)
Ig strand B 254..261 CDD:409540 2/6 (33%)
Ig strand C 267..273 CDD:409540 2/5 (40%)
Ig strand C' 276..281 CDD:409540 1/5 (20%)
Ig strand E 284..290 CDD:409540 2/5 (40%)
Ig strand F 293..304 CDD:409540 3/10 (30%)
Ig strand G 307..318 CDD:409540 3/10 (30%)
ceacam8lXP_031761715.1 Ig 29..132 CDD:472250 23/74 (31%)
Ig strand B 44..48 CDD:409353
Ig strand C 57..61 CDD:409353 1/2 (50%)
Ig strand E 98..102 CDD:409353 2/3 (67%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/3 (0%)
Ig 139..222 CDD:472250 34/86 (40%)
Ig strand B 154..158 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 2/3 (67%)
Ig strand E 186..190 CDD:409353 2/3 (67%)
Ig strand F 200..205 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 2/2 (100%)
Ig_3 236..291 CDD:464046 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.