DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arg and ARGAH1

DIOPT Version :9

Sequence 1:NP_524875.1 Gene:arg / 46717 FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_192629.1 Gene:ARGAH1 / 826468 AraportID:AT4G08900 Length:342 Species:Arabidopsis thaliana


Alignment Length:316 Identity:74/316 - (23%)
Similarity:124/316 - (39%) Gaps:81/316 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SLGIIGVPFAKGQA-KQGVELAPDLLRQ-------SSLRQVLQSSHDGLVIRDYGNL------QY 81
            |..::|||.....: .||...||..:|:       :|..:..:...|..|:.|.|::      ..
plant    64 STSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDVPVQEIRDC 128

  Fly    82 AVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVEN-TQFLAIGGDHAIGFGSVAGHLQH 145
            .||:..|.                   ..:.|.|||::.|. .:.|.:||||:|.:..|....:.
plant   129 GVDDDRLM-------------------NVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEK 174

  Fly   146 TPN-LSLVWIDAHADI------NLHSTSQSGNIHGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKD 203
            ... :.::.:|||.||      |.:|       |....:.::|        .|...         
plant   175 LGGPVDILHLDAHPDIYDCFEGNKYS-------HASSFARIME--------GGYAR--------- 215

  Fly   204 QLVYIGLRDIDPYEAFILNKVGIRYYAMDTI--DRVGVPKIIEMTLDALNPQNKIHVSFDIDALD 266
            :|:.:|:|.|:........:.|:..|.|.|.  ||   |.:..:.|.  .....:::|.|:|.||
plant   216 RLLQVGIRSINQEGREQGKRFGVEQYEMRTFSKDR---PMLENLKLG--EGVKGVYISIDVDCLD 275

  Fly   267 SNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERDVRTTVE 322
            ...||.......|||:.|:.::|:..|:  ..|.|.|:||.||:       |.||:
plant   276 PAFAPGVSHIEPGGLSFRDVLNILHNLQ--ADVVGADVVEFNPQ-------RDTVD 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 73/315 (23%)
ARGAH1NP_192629.1 PLN02615 2..342 CDD:178224 74/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4387
eggNOG 1 0.900 - - E1_COG0010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2619
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.