DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arg and ARGAH2

DIOPT Version :9

Sequence 1:NP_524875.1 Gene:arg / 46717 FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_192626.1 Gene:ARGAH2 / 826458 AraportID:AT4G08870 Length:344 Species:Arabidopsis thaliana


Alignment Length:308 Identity:72/308 - (23%)
Similarity:126/308 - (40%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IIGVPFAKGQA-KQGVELAPDLLRQ-------SSLRQVLQSSHDGLVIRDYGNL------QYAVD 84
            ::|||.....: .:|..|||..:|:       :|..:..:...|..|:.|.|::      :..||
plant    69 LLGVPLGHNSSFLEGPALAPPHVREAIWCGSTNSTTEEGKELKDPRVLSDVGDIPVQEIREMGVD 133

  Fly    85 EPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLVEN-TQFLAIGGDHAIGFGSVAGHLQHTPN 148
            :..|.                   :.:.|.|||::.|. .:.|.|||||:|.:..|....:....
plant   134 DDRLM-------------------KVVSESVKLVMEEEPLRPLVIGGDHSISYPVVRAVSEKLGG 179

  Fly   149 -LSLVWIDAHADINLHSTSQSGNIHGMPVSF--LLEQLRNTWQHAGLQEIAPNCLPKDQLVYIGL 210
             :.::.:|||.||   .....||.:....||  ::|        .|...         :|:.:|:
plant   180 PVDILHLDAHPDI---YDRFEGNYYSHASSFARIME--------GGYAR---------RLLQVGI 224

  Fly   211 RDIDPYEAFILNKVGIRYYAMDTI--DRVGVPKIIEMTLDALNPQNKIHVSFDIDALDSNVAPST 273
            |.|:........:.|:..|.|.|.  ||    :::| .|........:::|.|:|.||...|...
plant   225 RSINKEGREQGKRFGVEQYEMRTFSKDR----QMLE-NLKLGEGVKGVYISIDVDCLDPGFAHGV 284

  Fly   274 GTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERDVRTTV 321
            .....|||:.|:.::|:..|:..  :.|.|:||.||:..:..|:...|
plant   285 SHFEPGGLSFRDVLNILHNLQGD--LVGADVVEYNPQRDTADDMTAMV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 72/308 (23%)
ARGAH2NP_192626.1 PLN02615 1..344 CDD:178224 72/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4387
eggNOG 1 0.900 - - E1_COG0010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2619
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.