DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arg and Agmat

DIOPT Version :9

Sequence 1:NP_524875.1 Gene:arg / 46717 FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001041650.1 Gene:Agmat / 298607 RGDID:1308424 Length:353 Species:Rattus norvegicus


Alignment Length:291 Identity:75/291 - (25%)
Similarity:122/291 - (41%) Gaps:59/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IGVPFAKGQA-KQGVELAPDLLRQSSLRQVLQSSHDG------LVIRDYGNLQYAVDEPLLQQQR 92
            :|||...|.: :.|....|..:|:.||.....:...|      |.:.|.||:            .
  Rat    77 VGVPLDTGTSNRPGARFGPRRIREESLMLGTVNPSTGALPFQSLRVADLGNV------------N 129

  Fly    93 VHYHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGFGSV-AGHLQHTPNLSLVWIDA 156
            |:.:::::     :| |.:.|..:.:|......|.:||||.|.:..: |...:|.| :.||.:.|
  Rat   130 VNLYNLQD-----SC-RLIREAYQNILATGCIPLTLGGDHTITYPILQAVAKEHGP-VGLVHVGA 187

  Fly   157 HADINLHSTSQSGNIHGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKDQLVYIGL----RDIDPYE 217
            |::.: ....:....|..|....:::        ||       |...::|.||:    |.:|||.
  Rat   188 HSNTS-DKPLEDKVYHRTPFRRSVDE--------GL-------LDSKRVVQIGIRGSSRTLDPYR 236

  Fly   218 AFILNKVGIR-YYAMDTIDRVGVPKIIEMTLDALNPQN---KIHVSFDIDALDSNVAPSTGTAVR 278
              .....|.| ..|.|...:..||.:.|     :..|.   .:::||.|||||...||.|||...
  Rat   237 --YSRSQGFRVVLAEDCWMKSLVPLMAE-----IRQQMGGVPLYISFAIDALDPAYAPGTGTPEI 294

  Fly   279 GGLTLREGISIVEALRDTKRVQGVDLVEINP 309
            .|||..:.:.|:...:.. .|.|.||||::|
  Rat   295 AGLTPSQALEIIRGCQGL-NVVGCDLVEVSP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 75/291 (26%)
AgmatNP_001041650.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..52
Agmatinase_PAH 57..344 CDD:212538 75/291 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0010
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.