DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment arg and Arg2

DIOPT Version :9

Sequence 1:NP_524875.1 Gene:arg / 46717 FlyBaseID:FBgn0023535 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_033835.1 Gene:Arg2 / 11847 MGIID:1330806 Length:354 Species:Mus musculus


Alignment Length:316 Identity:129/316 - (40%)
Similarity:192/316 - (60%) Gaps:19/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYA---VDEPLLQQQR 92
            |:.|:|.||::||.|.|||..|..:|::.|.:.|  |..|..::|:|:|.:.   .|:|      
Mouse    25 SVAIVGAPFSRGQKKLGVEYGPAAIREAGLLKRL--SRLGCHLKDFGDLSFTNVPQDDP------ 81

  Fly    93 VHYHHIRNYADFMA-CNRALIEQVKLMLVENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDA 156
              |:::..|...:. .|:.|.|.|...:......:.:||||::..|::.||.:|.|:|.::|:||
Mouse    82 --YNNLVVYPRSVGLANQELAEVVSRAVSGGYSCVTMGGDHSLAIGTIIGHARHRPDLCVIWVDA 144

  Fly   157 HADINLHSTSQSGNIHGMPVSFLLEQLRN-TWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFI 220
            |||||...|:.||||||.|:|||:::|:: ..|..|...|.| ||....:|||||||::|.|.||
Mouse   145 HADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKP-CLSPPNIVYIGLRDVEPPEHFI 208

  Fly   221 LNKVGIRYYAMDTIDRVGVPKIIEMTLDAL--NPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTL 283
            |....|:|::|..|||:|:.|::|.|.|.|  ..|..||:||||||.|..:||:|||.|.||||.
Mouse   209 LKNYDIQYFSMREIDRLGIQKVMEQTFDRLIGKRQRPIHLSFDIDAFDPKLAPATGTPVVGGLTY 273

  Fly   284 REGISIVEALRDTKRVQGVDLVEINPKLG-SERDVRTTVESGLEILKSMFGYRRSG 338
            |||:.|.|.:.:|..:..:||||:||.|. ||.:.:.|....::::.|.||..|.|
Mouse   274 REGVYITEEIHNTGLLSALDLVEVNPHLATSEEEAKATARLAVDVIASSFGQTREG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
argNP_524875.1 Arginase 32..331 CDD:212515 123/306 (40%)
Arg2NP_033835.1 Arginase 26..321 CDD:212515 123/305 (40%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P05089 145..149 3/3 (100%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P05089 156..158 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836781
Domainoid 1 1.000 220 1.000 Domainoid score I2611
eggNOG 1 0.900 - - E1_COG0010
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H906
Inparanoid 1 1.050 232 1.000 Inparanoid score I3418
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56454
OrthoDB 1 1.010 - - D1179130at2759
OrthoFinder 1 1.000 - - FOG0001970
OrthoInspector 1 1.000 - - otm44371
orthoMCL 1 0.900 - - OOG6_102008
Panther 1 1.100 - - O PTHR43782
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R79
SonicParanoid 1 1.000 - - X1288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.