DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)09851 and Wdr59

DIOPT Version :9

Sequence 1:NP_001260713.1 Gene:l(2)09851 / 46662 FlyBaseID:FBgn0022288 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_609485.4 Gene:Wdr59 / 34540 FlyBaseID:FBgn0032339 Length:969 Species:Drosophila melanogaster


Alignment Length:274 Identity:65/274 - (23%)
Similarity:105/274 - (38%) Gaps:47/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 YAASWSEL---GRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGV 237
            |:..|..|   |.:.:..|.|...::...:...:||.|.|.            |||..|......
  Fly    50 YSGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAE------------FAICPSRKEYCA 102

  Fly   238 LATGDCRRDIHVWTPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRAS 302
            :||.. ..||..|...|...    :..|.||:::|.|:.|...:.::|.|||:|....|||.| .
  Fly   103 IATSQ-HIDIVRWGTAEPHY----EMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDLR-E 161

  Fly   303 PQKACMLTCEDAHQSDVNVISWNRNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTV 367
            |:|.. |:......|....:.:||....:.:...||.|.|||:|  :...|......|.:.:..:
  Fly   162 PRKPA-LSLNAVCMSGATQVGFNRVSGNLLAAAHDGDLRIWDIR--KGSCPTHYITAHLNRVHGI 223

  Fly   368 EWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPP--------------QLL 418
            .||....|.||:...|..:..:|:.         :|.:.|.::..:.|              .::
  Fly   224 NWSHKRETCLATASQDGTVKYFDVC---------NPRRAEKIITTMSPVWRARYTPIGNGLVSIV 279

  Fly   419 FIHQGQKEIKELHW 432
            ..|.|:.|...|.|
  Fly   280 VPHLGRGENSLLLW 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)09851NP_001260713.1 CAF1C_H4-bd 53..120 CDD:289068
WD40 152..>395 CDD:295369 57/221 (26%)
WD40 <172..>447 CDD:225201 65/274 (24%)
WD40 repeat 226..267 CDD:293791 11/40 (28%)
WD40 repeat 272..312 CDD:293791 15/39 (38%)
WD40 repeat 320..357 CDD:293791 10/36 (28%)
Wdr59NP_609485.4 WD40 <92..343 CDD:225201 54/220 (25%)
WD40 repeat 132..170 CDD:293791 15/39 (38%)
WD40 repeat 178..213 CDD:293791 10/36 (28%)
WD40 repeat 220..259 CDD:293791 9/47 (19%)
WD40 repeat 263..306 CDD:293791 5/31 (16%)
WD40 repeat 312..341 CDD:293791
mRING-H2-C3H3C2_WDR59 912..957 CDD:319606
modified RING-H2 finger (C3H3C2-type) 914..953 CDD:319606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.