Sequence 1: | NP_001260713.1 | Gene: | l(2)09851 / 46662 | FlyBaseID: | FBgn0022288 | Length: | 456 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291658.1 | Gene: | wdr59 / 103909113 | ZFINID: | ZDB-GENE-120215-187 | Length: | 982 | Species: | Danio rerio |
Alignment Length: | 244 | Identity: | 58/244 - (23%) |
---|---|---|---|
Similarity: | 97/244 - (39%) | Gaps: | 45/244 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 IDWSP---SADGVLATGDCRRDIHVWTPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCS 289
Fly 290 VDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWNRNEPFIASGGDDGYLHIWDLRQFQSKKPI 354
Fly 355 ATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWD----------LAVEKDIDQAVDPAQNEDV 409
Fly 410 LNKLPPQL-------------------LFIHQGQKE-IKELHWHPQLPG 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(2)09851 | NP_001260713.1 | CAF1C_H4-bd | 53..120 | CDD:289068 | |
WD40 | 152..>395 | CDD:295369 | 47/179 (26%) | ||
WD40 | <172..>447 | CDD:225201 | 58/244 (24%) | ||
WD40 repeat | 226..267 | CDD:293791 | 11/41 (27%) | ||
WD40 repeat | 272..312 | CDD:293791 | 14/39 (36%) | ||
WD40 repeat | 320..357 | CDD:293791 | 10/36 (28%) | ||
wdr59 | XP_009291658.1 | WD40 | <34..314 | CDD:225201 | 58/244 (24%) |
WD40 repeat | 62..103 | CDD:293791 | 11/41 (27%) | ||
WD40 | 97..>325 | CDD:295369 | 48/208 (23%) | ||
WD40 repeat | 109..150 | CDD:293791 | 14/44 (32%) | ||
WD40 repeat | 154..187 | CDD:293791 | 10/34 (29%) | ||
WD40 repeat | 195..229 | CDD:293791 | 7/33 (21%) | ||
WD40 repeat | 237..279 | CDD:293791 | 4/41 (10%) | ||
RWD | <418..484 | CDD:295432 | |||
Zn_ribbon_17 | 932..980 | CDD:305234 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0302 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |