DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)09851 and wdr59

DIOPT Version :9

Sequence 1:NP_001260713.1 Gene:l(2)09851 / 46662 FlyBaseID:FBgn0022288 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_009291658.1 Gene:wdr59 / 103909113 ZFINID:ZDB-GENE-120215-187 Length:982 Species:Danio rerio


Alignment Length:244 Identity:58/244 - (23%)
Similarity:97/244 - (39%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 IDWSP---SADGVLATGDCRRDIHVWTPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCS 289
            :.|:|   .|....|:.:.|.|::.|   .||:.| ....|.||::.:.||.||..|...|.:.|
Zfish    65 VQWNPHKSDAHIFAASSNQRVDLYTW---RDGSGK-SHTSLQGHTRVISDLDWSWFEPEFLVTSS 125

  Fly   290 VDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWNRNEPFIASGGDDGYLHIWDLRQFQSKKPI 354
            ||..|.|||...:.:....|:.    .:..:.:.|||...:..:...||.:.|||.|  :|...:
Zfish   126 VDTYIYIWDTSDTRRPTVTLSA----VAGASQVKWNRRNHYCLASSHDGDVRIWDKR--KSNTAV 184

  Fly   355 ATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWD----------LAVEKDIDQAVDPAQNEDV 409
            .....|...|..::|.|....:||:...|:.:..||          |:.:..:.:|.....:..:
Zfish   185 EYVAAHLSKINGLDWHPDNEYILATSSQDNSVRFWDYRQPRKYLDILSCQVPVWKARYTPFSNGL 249

  Fly   410 LNKLPPQL-------------------LFIHQGQKE-IKELHWHPQLPG 438
            :..:.|||                   .|:  |..: :.|..|.||..|
Zfish   250 VTVMVPQLRRENSLLLWSTLELNSPVHAFV--GHDDVVYEFQWRPQKEG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)09851NP_001260713.1 CAF1C_H4-bd 53..120 CDD:289068
WD40 152..>395 CDD:295369 47/179 (26%)
WD40 <172..>447 CDD:225201 58/244 (24%)
WD40 repeat 226..267 CDD:293791 11/41 (27%)
WD40 repeat 272..312 CDD:293791 14/39 (36%)
WD40 repeat 320..357 CDD:293791 10/36 (28%)
wdr59XP_009291658.1 WD40 <34..314 CDD:225201 58/244 (24%)
WD40 repeat 62..103 CDD:293791 11/41 (27%)
WD40 97..>325 CDD:295369 48/208 (23%)
WD40 repeat 109..150 CDD:293791 14/44 (32%)
WD40 repeat 154..187 CDD:293791 10/34 (29%)
WD40 repeat 195..229 CDD:293791 7/33 (21%)
WD40 repeat 237..279 CDD:293791 4/41 (10%)
RWD <418..484 CDD:295432
Zn_ribbon_17 932..980 CDD:305234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0302
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.