DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and GUCA1C

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_005450.3 Gene:GUCA1C / 9626 HGNCID:4680 Length:209 Species:Homo sapiens


Alignment Length:126 Identity:37/126 - (29%)
Similarity:66/126 - (52%) Gaps:9/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SGALSVDEFMSLPELQ-----QNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKL-SKLR 93
            ||..::.||.:|..||     .|..:.:|.:.||.:.:|.|||.|||..|:  .:..:|: .||:
Human    32 SGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIAAVN--LIMQEKMEQKLK 94

  Fly    94 FAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDT-QLQQIVDKTIGFADKDEDGKISFDEF 153
            :.|::||.|.:|.|...||..:...:...|.:.| ..::.::......|.:.||:::.:||
Human    95 WYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 37/126 (29%)
GUCA1CNP_005450.3 FRQ1 15..165 CDD:227455 37/126 (29%)
EFh 56..118 CDD:238008 22/63 (35%)
EFh 92..160 CDD:238008 17/64 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.