DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CPK30

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_177612.2 Gene:CPK30 / 843813 AraportID:AT1G74740 Length:541 Species:Arabidopsis thaliana


Alignment Length:163 Identity:45/163 - (27%)
Similarity:76/163 - (46%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMS--------LPELQQNPLVQRVIDIFDADGN 67
            :..:....|:..:...|..:|.||.|.:|..|..:        |.|    |.::.::::.|.:||
plant   353 IAEHLSIQEVEVIRNMFTLMDDDNDGKISYLELRAGLRKVGSQLGE----PEIKLLMEVADVNGN 413

  Fly    68 GEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQI 132
            |.:|:.||:..:.... |.:.....|.||..:|.|..|||.:.||.:.|.    :.|.:.....|
plant   414 GCLDYGEFVAVIIHLQ-KMENDEHFRQAFMFFDKDGSGYIESEELREALT----DELGEPDNSVI 473

  Fly   133 VDKTIGFADKDEDGKISFDEFCSVV-GNTDIHK 164
            :| .:...|.|:||||::|||..:: ..||..|
plant   474 ID-IMREVDTDKDGKINYDEFVVMMKAGTDWRK 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 41/148 (28%)
CPK30NP_177612.2 STKc_CAMK 58..316 CDD:270687
PTZ00184 353..497 CDD:185504 42/153 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.