DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CBL8

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:171 Identity:54/171 - (31%)
Similarity:84/171 - (49%) Gaps:25/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKL--DLDNSGALSVDEFM-------SLPELQQNPLVQRVIDIFDADGNGEV 70
            |..:||..|...|:||  .:.|.|.:..:||:       |:    ||....||..:||...||.:
plant    31 FTVNEIEALHDLFKKLSTSIINDGLIHKEEFLLALFRNGSM----QNLFADRVFYMFDRKRNGVI 91

  Fly    71 DFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQL------ 129
            :|.||::.:|.|.....:..|..|.|:::|:...|:|...|    ||.|||..|.:|.|      
plant    92 EFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPHE----LKKMVGALLGETDLELSEES 152

  Fly   130 -QQIVDKTIGFADKDEDGKISFDEFCSVVG-NTDIHKKMVV 168
             :.||::|:...|.::||||..:|:..:|. |..|.|.|.:
plant   153 IEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSILKNMTL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 49/154 (32%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 51/163 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.