DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CBL2

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001332655.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:151 Identity:49/151 - (32%)
Similarity:82/151 - (54%) Gaps:8/151 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKLD--LDNSGALSVDEF---MSLPELQQNPLVQRVIDIFDADGNGEVDFKE 74
            |...||..|.:.|:|:.  :.:.|.::.:||   :.....:::....||.|:||...||.:.|:|
plant    42 FSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEE 106

  Fly    75 FIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV---GNNLKDTQLQQIVDKT 136
            |.:.:|.|........|:.|:|::||:...|:|...|:.|::...:   |.|||||.::.|:|||
plant   107 FARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKT 171

  Fly   137 IGFADKDEDGKISFDEFCSVV 157
            ...||...||||..:|:.|:|
plant   172 FEEADTKHDGKIDKEEWRSLV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 47/146 (32%)
CBL2NP_001332655.1 FRQ1 36..198 CDD:227455 49/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.