DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and SOS3

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001190377.1 Gene:SOS3 / 832494 AraportID:AT5G24270 Length:222 Species:Arabidopsis thaliana


Alignment Length:163 Identity:46/163 - (28%)
Similarity:84/163 - (51%) Gaps:9/163 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKL--DLDNSGALSVDEF---MSLPELQQNPLVQRVIDIFDADGNGEVDFKE 74
            |..:|:..|.:.|:||  .:.:.|.:..:||   :.....::|....|:.|:||...||.::|.|
plant    31 FTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRNRNRRNLFADRIFDVFDVKRNGVIEFGE 95

  Fly    75 FIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN---LKDTQLQQIVDKT 136
            |::.:..|........|::|||::||:...|:|...||.:::..::..:   |.:..::.:|||.
plant    96 FVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKA 160

  Fly   137 IGFADKDEDGKISFDEFCSVVG-NTDIHKKMVV 168
            ...||:..||||..||:...|. |..:.|.|.:
plant   161 FVQADRKNDGKIDIDEWKDFVSLNPSLIKNMTL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 42/146 (29%)
SOS3NP_001190377.1 FRQ1 29..187 CDD:227455 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.