DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CBL7

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:132 Identity:35/132 - (26%)
Similarity:69/132 - (52%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GALSVDEF-MSLPELQQNPLV--QRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFR 97
            |.::.::| :::.:..:|..:  :||.|:||.:.:|.:.|:||.:.:|.|........|:..:|:
plant    53 GEMNKEQFHVAIFQTDKNESLFSERVFDLFDTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQ 117

  Fly    98 IYDMDNDGYISNGELFQVLKMMV-------GNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCS 155
            :||:...|:|..    |.:|.:|       |.:..|..::.|:|||...||...:|.|..:|:..
plant   118 LYDLKQQGFIER----QGVKQLVVATLAASGMSQSDEIVESIIDKTFVQADTKHEGMIDEEEWMD 178

  Fly   156 VV 157
            :|
plant   179 LV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 34/127 (27%)
CBL7NP_194386.1 FRQ1 <74..186 CDD:227455 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.