DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and AT4G03290

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_192238.1 Gene:AT4G03290 / 827993 AraportID:AT4G03290 Length:154 Species:Arabidopsis thaliana


Alignment Length:149 Identity:40/149 - (26%)
Similarity:75/149 - (50%) Gaps:21/149 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DADEIRRLGKRFRKLDLDNSGALSVDEF--------MSLPELQQNPLVQRVIDIFDADGNGEVDF 72
            |:.|:.|:   |:..|.|..|.::..|.        :.:||.:...::|::    |.:|:|.||.
plant     2 DSTELNRV---FQMFDKDGDGKITTKELNESFKNLGIIIPEDELTQIIQKI----DVNGDGCVDI 59

  Fly    73 KEFIQGVSQFSVKG-DKLSK--LRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVD 134
            :||.:......|:. |::.:  ::.||.::|.:.||:|:..||..||..:   .||..:..:...
plant    60 EEFGELYKTIMVEDEDEVGEEDMKEAFNVFDRNGDGFITVDELKAVLSSL---GLKQGKTLEECR 121

  Fly   135 KTIGFADKDEDGKISFDEF 153
            |.|...|.|.||::::.||
plant   122 KMIMQVDVDGDGRVNYMEF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 40/149 (27%)
AT4G03290NP_192238.1 PTZ00184 5..144 CDD:185504 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.