DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CBL1

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001329533.1 Gene:CBL1 / 827481 AraportID:AT4G17615 Length:252 Species:Arabidopsis thaliana


Alignment Length:176 Identity:50/176 - (28%)
Similarity:89/176 - (50%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNETSLPMEMCSNFDADEIRRLGKRFRKL--DLDNSGALSVDEF---MSLPELQQNPLVQRVIDI 61
            |:|..:.:...:.|...|:..|.:.|:.:  .:.:.|.::.:||   :.....::|....|:.|:
plant    14 GHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLALFKSRKRENIFANRIFDM 78

  Fly    62 FDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN--- 123
            ||....|.:||.:|::.::.|........|:.|.||:||||..|||...|:.|:|..::..:   
plant    79 FDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVKQMLIALLCESEMK 143

  Fly   124 LKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVG-NTDIHKKMVV 168
            |.|..::.|:|||...||.::||||...|:...|. |..:.|.|.:
plant   144 LADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 44/148 (30%)
CBL1NP_001329533.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.