DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and MSS3

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_565996.1 Gene:MSS3 / 818931 AraportID:AT2G43290 Length:215 Species:Arabidopsis thaliana


Alignment Length:171 Identity:43/171 - (25%)
Similarity:77/171 - (45%) Gaps:28/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSLPMEMCSN-----FDADEIRRLGKRFRKLDLDNSGALSVDEF--------MSLPELQQNPLVQ 56
            |.||....|:     .|..|::|:   |:..|.:..|.::.:|.        :.:|:.....::.
plant    46 TMLPSPSSSSAPTKRIDPSELKRV---FQMFDKNGDGRITKEELNDSLENLGIYIPDKDLTQMIH 107

  Fly    57 RVIDIFDADGNGEVDFKEF----IQGVSQFSVKGD-KLSKLRFAFRIYDMDNDGYISNGELFQVL 116
            ::    ||:|:|.||..||    ...|.:....|: :...::.||.::|.|.||:|:..||..| 
plant   108 KI----DANGDGCVDIDEFESLYSSIVDEHHNDGETEEEDMKDAFNVFDQDGDGFITVEELKSV- 167

  Fly   117 KMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVV 157
              |....||..:......|.|...|.|.||::::.||..::
plant   168 --MASLGLKQGKTLDGCKKMIMQVDADGDGRVNYKEFLQMM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 39/158 (25%)
MSS3NP_565996.1 PTZ00184 64..206 CDD:185504 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.