DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Cib1

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_038948271.1 Gene:Cib1 / 81823 RGDID:620133 Length:203 Species:Rattus norvegicus


Alignment Length:178 Identity:45/178 - (25%)
Similarity:87/178 - (48%) Gaps:19/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNETSLPMEMCSNFD------ADEIRRLGKRF--------RKLDLDNSGALSVDEFMSLPELQQN 52
            |:.:.|..|:.:.:.      ..||....:||        |.::......:|.::.:|||||:.|
  Rat     3 GSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHTRVSFEQILSLPELKAN 67

  Fly    53 PLVQRVIDIFDADGNGE-VDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVL 116
            |..:|:..:|......: :.|::|:..:|.||.......|..:||||:|.|:||.:...:|.:::
  Rat    68 PFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSRLV 132

  Fly   117 KMMVG----NNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNT 160
            ..:.|    ..|..::::|::|..:..:|.|.||.|:..||..|:..:
  Rat   133 NCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 40/159 (25%)
Cib1XP_038948271.1 EFh 111..178 CDD:238008 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.