DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Chp2

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_081639.1 Gene:Chp2 / 70261 MGIID:1917511 Length:196 Species:Mus musculus


Alignment Length:174 Identity:61/174 - (35%)
Similarity:93/174 - (53%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
            :.|....:.||..||:.||.|..|.||..:...:..|..|||..|:||.|..:|:..:.|..|.:
Mouse    21 TGFSQASLLRLYHRFQALDRDEKGFLSRLDLQQIGALAVNPLGDRIIDSFFPNGSQRLYFAGFAR 85

  Fly    78 GVSQF----------------SVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKD 126
            .::.|                .....:::||||||::||:|.||.||..|:.|||::|||..:.|
Mouse    86 VLAYFRPIDEEDATLRDPKQPEPLNSRMNKLRFAFQLYDLDRDGKISRNEMLQVLRLMVGVQVTD 150

  Fly   127 TQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170
            .||:.|.|:|:..||:|.||.:||.||...:...:|.:||.:.:
Mouse   151 EQLESITDRTVQEADEDGDGAVSFLEFTKSLEKMNIEQKMSIRI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 57/156 (37%)
Chp2NP_081639.1 FRQ1 23..179 CDD:227455 58/155 (37%)
Nuclear export signal. /evidence=ECO:0000250 137..148 6/10 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.