DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Cib4

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_001068424.2 Gene:Cib4 / 688819 RGDID:1584147 Length:185 Species:Rattus norvegicus


Alignment Length:131 Identity:38/131 - (29%)
Similarity:69/131 - (52%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDK 88
            ||.:::      ..|::|:..|||.|:.||...|:..:|..|  ....|::.:...|.||.:...
  Rat    42 GKHYKE------ATLTMDQVSSLPALRVNPFRDRICRVFSHD--DVFSFEDVLGMASVFSEQACP 98

  Fly    89 LSKLRFAFRIYDMDNDGYISNGELFQ-VLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDE 152
            ..|:.:||||||.:.:|:|...:|.: ||:::..:::.:..||.:....:..:|.|.|..:||.|
  Rat    99 SLKIEYAFRIYDFNENGFIDEEDLQKIVLRLLKSDDVSEDLLQDVTHHVLSESDLDNDNMLSFSE 163

  Fly   153 F 153
            |
  Rat   164 F 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 38/131 (29%)
Cib4XP_001068424.2 FRQ1 21..173 CDD:227455 38/131 (29%)
EF-hand_7 101..168 CDD:404394 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.