DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Kcnip1

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_006246167.1 Gene:Kcnip1 / 65023 RGDID:70886 Length:245 Species:Rattus norvegicus


Alignment Length:160 Identity:45/160 - (28%)
Similarity:79/160 - (49%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MEMCSNFDADEIRRLGKRFRKLDLDN---SGALSVDEFMSL-----PELQQNPLVQRVIDIFDAD 65
            :|..:||...|::.|.:.|:     |   ||.::.:.|..:     |....:.....:.:.||..
  Rat    71 LEAQTNFTKRELQVLYRGFK-----NECPSGVVNEETFKQIYAQFFPHGDASTYAHYLFNAFDTT 130

  Fly    66 GNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKM---MVGNN---- 123
            ..|.|.|::|:..:| ..::|....|||:.|.:||::.||||:..|:..::|.   |:|..    
  Rat   131 QTGSVKFEDFVTALS-ILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPV 194

  Fly   124 LKDTQLQQIVDKTIGFADKDEDGKISFDEF 153
            ||:...:|.||......||::||.::.|||
  Rat   195 LKEDTPRQHVDVFFQKMDKNKDGIVTLDEF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 44/156 (28%)
Kcnip1XP_006246167.1 FRQ1 68..234 CDD:227455 45/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.