DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Chp1

DIOPT Version :10

Sequence 1:NP_524874.2 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:171 Identity:70/171 - (40%)
Similarity:99/171 - (57%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
            :.|...:|.||..||..||...:|.||.::|..:|||..|||..|:|:.|.::|..:|:|:.|::
  Rat    21 TGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMR 85

  Fly    78 GVSQF----------SVKG-----DKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDT 127
            .::.|          .|.|     .:.:||.||||:||:|.|..||..||.|||:||||.|:.|.
  Rat    86 TLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDE 150

  Fly   128 QLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            ||..|.|:||..||:|.|..|||.||..|:...|:.:||.:
  Rat   151 QLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_524874.2 FRQ1 20..157 CDD:444056 65/151 (43%)
Chp1NP_077053.1 Necessary for association with microtubule and interaction with GAPDH 2..6
FRQ1 27..182 CDD:444056 66/154 (43%)
Nuclear export signal 1 138..147 6/8 (75%)
Nuclear export signal 2 176..185 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.