DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Tesc

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_067319.2 Gene:Tesc / 57816 MGIID:1930803 Length:214 Species:Mus musculus


Alignment Length:189 Identity:46/189 - (24%)
Similarity:92/189 - (48%) Gaps:33/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGN------ 67
            :|..:.|.:|:|.:|.:||::|..|.. .:..:.|.::|:|:.||:..:::..|..:.|      
Mouse    14 LEGKTGFSSDQIEQLHRRFKQLSGDQP-TIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSS 77

  Fly    68 ---GEVDFKEFIQGVSQF----------SVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMM 119
               .|::|::|:..:|.|          .|:..:..||:|.|.:||.|:||.|:..|...|::.:
Mouse    78 GLADEINFEDFLTIMSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEEL 142

  Fly   120 VGNN----------LKDTQLQQIVDKTIGFADKDE--DGKISFDEFCSVVGNTDIHKKM 166
            :..|          :.|..:.:.....:|..:.|:  :| |:|::|..:....||..||
Mouse   143 LSGNPHIEKESARSIADGAMMEAASVCVGQMEPDQVYEG-ITFEDFLKIWQGIDIETKM 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 40/171 (23%)
TescNP_067319.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/5 (20%)
FRQ1 20..>142 CDD:227455 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.