DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Chp1

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_062743.1 Gene:Chp1 / 56398 MGIID:1927185 Length:195 Species:Mus musculus


Alignment Length:171 Identity:70/171 - (40%)
Similarity:99/171 - (57%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
            :.|...:|.||..||..||...:|.||.::|..:|||..|||..|:|:.|.::|..:|:|:.|::
Mouse    21 TGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMR 85

  Fly    78 GVSQF----------SVKG-----DKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDT 127
            .::.|          .|.|     .:.:||.||||:||:|.|..||..||.|||:||||.|:.|.
Mouse    86 TLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDE 150

  Fly   128 QLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            ||..|.|:||..||:|.|..|||.||..|:...|:.:||.:
Mouse   151 QLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 65/155 (42%)
Chp1NP_062743.1 Nuclear export signal 2. /evidence=ECO:0000250 176..185 2/8 (25%)
FRQ1 1..182 CDD:227455 67/160 (42%)
Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
Nuclear export signal 1. /evidence=ECO:0000250 138..147 6/8 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.