DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and PPP3R1

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_000936.1 Gene:PPP3R1 / 5534 HGNCID:9317 Length:170 Species:Homo sapiens


Alignment Length:170 Identity:149/170 - (87%)
Similarity:159/170 - (93%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDAD 65
            ||||.|.|:||||:||||||:||||||:||||||||:|||:||||||||||||||||||||||.|
Human     1 MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTD 65

  Fly    66 GNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQ 130
            |||||||||||:|||||||||||..||||||||||||.|||||||||||||||||||||||||||
Human    66 GNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ 130

  Fly   131 QIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170
            |||||||..||||.||:|||:|||:|||..||||||||||
Human   131 QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 125/140 (89%)
PPP3R1NP_000936.1 FRQ1 13..157 CDD:227455 127/143 (89%)
Calcineurin A binding. /evidence=ECO:0000269|PubMed:12218175, ECO:0000269|PubMed:12357034, ECO:0000269|PubMed:17498738, ECO:0000269|PubMed:22343722, ECO:0000269|PubMed:23468591, ECO:0000269|PubMed:26794871, ECO:0000269|PubMed:27974827, ECO:0000269|PubMed:8524402 131..136 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147790
Domainoid 1 1.000 122 1.000 Domainoid score I5645
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68099
Inparanoid 1 1.050 302 1.000 Inparanoid score I2681
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm40388
orthoMCL 1 0.900 - - OOG6_101614
Panther 1 1.100 - - LDO PTHR45942
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R164
SonicParanoid 1 1.000 - - X1796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.