DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and guca1d

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001011661.1 Gene:guca1d / 494573 ZFINID:ZDB-GENE-040724-231 Length:185 Species:Danio rerio


Alignment Length:127 Identity:38/127 - (29%)
Similarity:67/127 - (52%) Gaps:11/127 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SGALSVDEFMSLPELQ-----QNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRF 94
            ||.:::.|..|:..||     .|..|.:|...||.|.:|.:||.|:|..:| ..:||:...||::
Zfish    29 SGLITLFELKSILGLQGMNEDANSYVDQVFCTFDMDRDGYIDFVEYIAAIS-LMLKGEINQKLKW 92

  Fly    95 AFRIYDMDNDGYISNGEL---FQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEF 153
            .|:::|.|.:|.|...||   |..::.:..|  :|...::||.......|.:.:|:::.:||
Zfish    93 YFKLFDQDGNGKIDKDELETIFTAIQDITRN--RDIVPEEIVALIFEKIDVNGEGELTLEEF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 38/127 (30%)
guca1dNP_001011661.1 EF-hand_8 28..76 CDD:290545 16/46 (35%)
EFh 53..110 CDD:238008 20/57 (35%)
EF-hand_7 56..114 CDD:290234 21/58 (36%)
EFh 89..157 CDD:238008 18/66 (27%)
EF-hand_7 90..154 CDD:290234 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.