DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CG14362

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster


Alignment Length:185 Identity:52/185 - (28%)
Similarity:79/185 - (42%) Gaps:29/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLPME------MCSNFDADEIRRLGKRFRKLD---LDNSGALSVDEFMSLPELQQNPLVQRVID- 60
            |:|.|      |.:.....:|:.|..||.:..   .|....|....|.| ..||.|||:..::: 
  Fly    14 SVPQEIMNTLRMNTALSRSQIKYLYIRFHQFSGGGKDPPSHLHKYNFYS-GLLQLNPLLPTILNS 77

  Fly    61 IFDADGNGE----VDFKEFIQGVSQFSVKG---------DKLSKLRFAFRIYDMDNDGYISNGEL 112
            :|   ||..    |||..|:......|:|.         ||  |||..|.:||.:.||.|:..:|
  Fly    78 MF---GNKVTITFVDFALFLSTFQAHSLKTSNELKNVMMDK--KLRLIFNMYDNNKDGRITKYDL 137

  Fly   113 FQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMV 167
            ..|:..:..|.|...|:.:||:..:...|..:..:|.|.:||......|:.:.||
  Fly   138 VVVVHKLFSNLLDHVQIMRIVNTIMKEMDHTDSNQIMFQDFCKAFAVFDMTEMMV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 43/157 (27%)
CG14362NP_650320.1 EFh 116..183 CDD:238008 21/66 (32%)
EF-hand_7 117..182 CDD:290234 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.