DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and sunz

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster


Alignment Length:171 Identity:40/171 - (23%)
Similarity:65/171 - (38%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDA------------D 65
            :.|..:|:..|...|.|..|:|...:     ||..:|....||.  ..|||.            |
  Fly    31 TEFSTNEVVSLLIVFYKYALNNRSRM-----MSTSQLYNLFLVS--FGIFDVTIIDRISMNITQD 88

  Fly    66 GNGEVD------FKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVL--KMMVGN 122
            |.....      |..|..|..|        .:::|||.:| ......:.|.|:..|.  :...|:
  Fly    89 GRSVSPEAWMRLFCVFFNGSLQ--------ERMKFAFEVY-TSGGAVVLNREVVGVAIEQFFTGD 144

  Fly   123 NLKDTQLQQI----VDKTIGFADKDEDGKISFDEFCSVVGN 159
            :  |.::.::    .:...|..|.|:||.|:|:|:..:|.|
  Fly   145 D--DDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 38/164 (23%)
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.