DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CG15177

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster


Alignment Length:76 Identity:20/76 - (26%)
Similarity:36/76 - (47%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFA----DKDEDGKISFD 151
            :::|||.:||..|.|.|...::....:........:.:|.::......|.    |.|:||.|||:
  Fly   114 RMKFAFEVYDTKNTGVIDREQVGVACEKFFHEGDDEDELIELRADMTEFIMKKFDVDKDGVISFE 178

  Fly   152 EFCSVVGNTDI 162
            ::.|||....:
  Fly   179 DYSSVVSQQPV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 17/66 (26%)
CG15177NP_649672.1 EF-hand_7 115..180 CDD:290234 17/64 (27%)
EFh 116..179 CDD:298682 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.