DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and tescb

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_991256.1 Gene:tescb / 402993 ZFINID:ZDB-GENE-040426-1903 Length:216 Species:Danio rerio


Alignment Length:204 Identity:52/204 - (25%)
Similarity:97/204 - (47%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLP-------MEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRV 58
            ||:..|||       :...:.|..::|..|..||::|. .|...|..|:..::.:|:.||:..::
Zfish     1 MGSFQSLPDDHQYRTLSQKTGFSLEQIGILHNRFKQLS-QNEDTLRRDDLKTIQDLESNPIRSQI 64

  Fly    59 IDIF--------DADGN-GEVDFKEFIQGVSQFSVKGDKL----------SKLRFAFRIYDMDND 104
            |:.|        ||.|: .|:.|:||:..:|.|.....::          :||||.|.::|.|||
Zfish    65 IEAFFDKRNFQKDATGSVQEIGFEEFLTVMSYFRAPAHQITEEQREEIRRAKLRFLFNMHDTDND 129

  Fly   105 GYISNGELFQVLKMMVGNN----------LKDTQLQQIVDKTIGFADKDE--DGKISFDEFCSVV 157
            |.|:..|...|::.::..:          :.|..:.::...|:|....||  :| |:|::|..::
Zfish   130 GTITLEEYRHVVEELLSRSGALGRETAKGIADAAMLEVASITVGPMAPDEFYEG-ITFEQFLKIL 193

  Fly   158 GNTDIHKKM 166
            ...:|..:|
Zfish   194 KGVEIETRM 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 44/171 (26%)
tescbNP_991256.1 FRQ1 14..>144 CDD:227455 36/130 (28%)
EFh 116..>144 CDD:298682 13/27 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.