DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and chp2

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_956130.1 Gene:chp2 / 327599 ZFINID:ZDB-GENE-030131-5810 Length:195 Species:Danio rerio


Alignment Length:191 Identity:67/191 - (35%)
Similarity:99/191 - (51%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMEMCSN---------FDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQ 56
            ||:.:|..::...|         |....|.||.:||..||.:..|.|...:|.::.||..||:..
Zfish     1 MGSSSSTLLKKIPNVDELMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAMNPIGD 65

  Fly    57 RVIDIFDADGNGEVDFKEFIQGVSQF-SVKGD-------------KLSKLRFAFRIYDMDNDGYI 107
            |:||.|.:.|...|||..|::.::.| .|..|             :.:||:|||::||.|.||.|
Zfish    66 RIIDAFFSPGKDTVDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQLYDQDKDGKI 130

  Fly   108 SNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            |..||.:||:.|:|..:.:.||:.|.|:||..||.|.|..|||:||...:...:|..||.:
Zfish   131 SRDELLKVLRDMLGLQVTEEQLESIADRTIQEADLDRDDAISFEEFRKSLEKVNIDHKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 60/163 (37%)
chp2NP_956130.1 FRQ1 17..178 CDD:227455 60/160 (38%)
EFh 114..178 CDD:238008 33/63 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.