DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Chp2

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_038934165.1 Gene:Chp2 / 308965 RGDID:727796 Length:252 Species:Rattus norvegicus


Alignment Length:201 Identity:68/201 - (33%)
Similarity:102/201 - (50%) Gaps:38/201 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETS----LPMEMCSNFDADEIR-----------RLGKRFRKLDLDNSGALSVDEFMSLPELQ 50
            ||:.:|    :|       |.|:||           ||..||:.||.:..|.||..:...:..|.
  Rat    57 MGSRSSHVALIP-------DVDQIRRETGFSQASLLRLYHRFQALDREEKGFLSRLDLQQIGALA 114

  Fly    51 QNPLVQRVIDIFDADGNGEVDFKEFIQGVSQF----------------SVKGDKLSKLRFAFRIY 99
            .|||..|:||.|..:|:..|.|..|.:.::.|                .....:::||||||::|
  Rat   115 VNPLGDRIIDSFFPNGSQRVYFAGFARVLAYFRPIDEDDATLRDPKQPEPLNSRMNKLRFAFQLY 179

  Fly   100 DMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHK 164
            |:|.||.||..|:.|||::|||..:.|.||:.|.|:|:..||:|.||.:||.||...:...:|.:
  Rat   180 DLDRDGKISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFAKSLEKMNIEQ 244

  Fly   165 KMVVDV 170
            ||.:.:
  Rat   245 KMSIRI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 60/167 (36%)
Chp2XP_038934165.1 FRQ1 79..235 CDD:227455 57/155 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.