DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Ppp3r2

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_067733.1 Gene:Ppp3r2 / 29749 RGDID:69232 Length:176 Species:Rattus norvegicus


Alignment Length:170 Identity:129/170 - (75%)
Similarity:145/170 - (85%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDAD 65
            ||||.|...||.::||.|||:|||:.|:|:|||.||:||||||||||||||||||.|||||||.|
  Rat     1 MGNEASYHSEMGTHFDHDEIKRLGRSFKKMDLDKSGSLSVDEFMSLPELQQNPLVGRVIDIFDTD 65

  Fly    66 GNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQ 130
            |||||||:|||.|.||||||||:..|||||||||||||||:||||||||||||||||||||.|||
  Rat    66 GNGEVDFREFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDWQLQ 130

  Fly   131 QIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170
            |:|||:|...|||.||:|||:||..||...:||||:||.|
  Rat   131 QLVDKSILVLDKDGDGRISFEEFRDVVRTMEIHKKLVVFV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 112/140 (80%)
Ppp3r2NP_067733.1 FRQ1 13..157 CDD:227455 113/143 (79%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:P63098 131..136 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101614
Panther 1 1.100 - - O PTHR45942
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1796
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.