DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Tescl

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001099703.1 Gene:Tescl / 292706 RGDID:1311676 Length:232 Species:Rattus norvegicus


Alignment Length:195 Identity:48/195 - (24%)
Similarity:90/195 - (46%) Gaps:38/195 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDAD---GNG-- 68
            |:.| :|..|:|::|.:|||.|..|.. .|..:.|.::.:|:.||:..|::..|..:   |.|  
  Rat    29 MKKC-DFSWDQIKQLHQRFRLLSGDQP-TLRPENFDNVLDLEFNPIRSRIVRAFFDNRNLGKGTS 91

  Fly    69 ----EVDFKEFIQGVSQF----------SVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLK-M 118
                |:.|::|:..:|.|          ..:..:..|::|.|.:||.|.||.|:..|..:|:: :
  Rat    92 GLAEEITFQDFLTIISYFRPLEPRPNKEEAEQYRKEKMQFLFNMYDQDGDGIITLQEYRRVVEDL 156

  Fly   119 MVGNNLKDTQLQQIVDKTIGFA---------------DKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            :..|...:|...:.|..:|...               |:..:| |:|::|.....:.::..||.|
  Rat   157 LSANPQAETATVRSVANSIARVALMEASRASDQPLNEDEPYEG-ITFEDFFKTWQSLELEVKMQV 220

  Fly   169  168
              Rat   221  220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 42/175 (24%)
TesclNP_001099703.1 PTZ00183 30..206 CDD:185503 43/178 (24%)
EFh 128..>165 CDD:298682 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.